Align L-arabinolactonase (EC 3.1.1.15) (characterized)
to candidate WP_050464917.1 AKL27_RS21505 SMP-30/gluconolactonase/LRE family protein
Query= reanno::ANA3:7024914 (300 letters) >NCBI__GCF_001189915.1:WP_050464917.1 Length = 297 Score = 155 bits (391), Expect = 1e-42 Identities = 90/270 (33%), Positives = 141/270 (52%), Gaps = 11/270 (4%) Query: 18 RLGEGVLWDDLHQSIWWTDILSSVIYRFHLASRSLETFPMPHRVGSFGLTAKPTTLIVAF 77 +LGE LW +++W DI ++R + ++P+P G A LIVA Sbjct: 15 QLGESPLWHAAESALYWIDIPGRAVHRLDTRNDQHRSWPLPAEPGCIARDADGG-LIVAL 73 Query: 78 DIGIAIYDIEDQSLTWLAQPESHFAGNRFNDGRIDRQGRFWAGTMVEQRDTLQQTAALYC 137 G++ D + LT + RFNDGR D GR W GT+ E RD L +L+C Sbjct: 74 RTGLSHLDTDTGGLTPMLDAPYDQDKIRFNDGRCDAMGRLWTGTIYEPRDQL--LGSLFC 131 Query: 138 LDEKGHCHQHLTNLEISNGLCWSVDGRTLYHADSPKHQIYQYDFDIEQGLLSRKRLF--- 194 + E+G + SNG+ +S D R +YHA++P H+I+ YDFD+ G+ S +RLF Sbjct: 132 I-ERGRIRDARHAVTTSNGVAFSNDHRLMYHANTPAHRIHVYDFDLATGITSNQRLFKQF 190 Query: 195 ----ASTSHHIFPDGSDVDAAGYLWNAQWGGGQVVRYRPDGEVDLILKLPVTHPTSIAFG 250 + ++ PDG+ VD+ W A + GG+++R G++ + LPV PT +AFG Sbjct: 191 DTDKTAANYGGRPDGAAVDSENAYWCAMFEGGRLLRLSASGDILQEIALPVRCPTMVAFG 250 Query: 251 GEKRDLLIVTSAKHSLDASQLDQEPQAGDV 280 G+ L +T+ +H+ +L+Q P +G V Sbjct: 251 GDDLRTLYITTGRHNRSPQELEQYPLSGCV 280 Lambda K H 0.322 0.139 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 297 Length adjustment: 27 Effective length of query: 273 Effective length of database: 270 Effective search space: 73710 Effective search space used: 73710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory