Align L-2-keto-3-deoxyrhamnonate 4-dehydrogenase subunit (EC 1.1.1.401) (characterized)
to candidate WP_050465009.1 AKL27_RS21970 FAA hydrolase family protein
Query= metacyc::MONOMER-16233 (285 letters) >NCBI__GCF_001189915.1:WP_050465009.1 Length = 310 Score = 175 bits (444), Expect = 1e-48 Identities = 103/255 (40%), Positives = 141/255 (55%), Gaps = 14/255 (5%) Query: 27 SGVVPELTIEALAAAKGADVASLPLVEGEPRYGVPVKGIGKIVAIGLNYEDHAIESNLPI 86 SG V +L A + + PL R VP G+I A N+ DHA E + Sbjct: 58 SGAVAQLAAAVPALSAAGRIR--PLDAKAYRLAVPFTP-GRIFATASNFYDHAAEMGTEL 114 Query: 87 P----TEPMMFMKALSSLNGPNDEVVLPKNSTHGDWEVELGVVIGETCRFVSEDEALSKV 142 + P FMKA +S+ + VV+P+++ DWEVELGV+IG C+ VS +A + Sbjct: 115 APRSESSPYCFMKAETSVTATDTNVVMPRDTEKLDWEVELGVIIGRRCKDVSVADAYDMI 174 Query: 143 AGYVLVNDVSERFNQKQRGT----QWSKGKGHDTFCPVGPWLVTPDEVGDPQDLDMHLNV 198 AGY + ND+S R ++ W +GK DTF P+GPW V D + +PQ L M L V Sbjct: 175 AGYTVFNDISARDLNRRSDYPFKHDWFRGKSFDTFGPMGPWFVPRDCIREPQKLRMQLQV 234 Query: 199 NGTRMQTGNTKTMIFNVAQLISYVSEYITLYPGDLMITGTPPGVGEGKKPQAIYLKAGDV 258 NG MQ G + MIFN+A+ I+Y+S +TL PGD++ TGTP GVG G+ +YLK GD Sbjct: 235 NGDMMQDGTGEAMIFNIAEQIAYLSSILTLQPGDMIATGTPDGVGMGR---GVYLKPGDE 291 Query: 259 MELGIEKLGTQRQQV 273 M IE +G+ R V Sbjct: 292 MIASIEAIGSIRNTV 306 Lambda K H 0.316 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 310 Length adjustment: 26 Effective length of query: 259 Effective length of database: 284 Effective search space: 73556 Effective search space used: 73556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory