Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_050783561.1 MNOD_RS26775 3-oxoacyl-ACP reductase
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >NCBI__GCF_000022085.1:WP_050783561.1 Length = 265 Score = 149 bits (377), Expect = 5e-41 Identities = 96/250 (38%), Positives = 129/250 (51%), Gaps = 6/250 (2%) Query: 19 LKNKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEKVETVAAHWRERGADVHALKAD 78 L +V L+TGA +GIG +I FA A +VI+D+ E R G D Sbjct: 6 LDGRVALVTGAGRGIGSSIAHGFAQAGATVVINDVDPTAAEAACERLRAEGLKAEPQPFD 65 Query: 79 VSNQQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPLEMTE-EDWRRCFAIDLDGAWYGC 137 V++ A V RHG++D+L+N AG+ + R P+E E DW + AI+L + Sbjct: 66 VTDHPAGAAAIEAIVARHGKLDILMNNAGI-LIRKPVETHEIADWDKVIAINLTSLYALA 124 Query: 138 KAVLPQMIEQGVGSIINIASTHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVNA 197 + M + G G IIN AS PG Y AKHG++G+TRAL E P G+ VNA Sbjct: 125 REATRHMRKAGYGRIINTASLMGISSRPGVISYVAAKHGVVGITRALAAELGPYGITVNA 184 Query: 198 IAPGYIETQLNVDYWNGFADPYAERQRALDLHPPRRIGQPIEVAMTAVFLASDEAPFINA 257 I PGYIETQ+N AD +Q +D P R P E+A AVFLAS A F++ Sbjct: 185 IGPGYIETQINK---ATLADGRFHKQ-VVDRTPLGRWASPDELAGPAVFLASAAAGFVSG 240 Query: 258 SCITIDGGRS 267 + +DGG S Sbjct: 241 HVLMVDGGMS 250 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 265 Length adjustment: 25 Effective length of query: 247 Effective length of database: 240 Effective search space: 59280 Effective search space used: 59280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory