Align Indolepyruvate oxidoreductase subunit IorB; IOR; Indolepyruvate ferredoxin oxidoreductase subunit beta; EC 1.2.7.8 (characterized)
to candidate WP_051185090.1 H567_RS27455 hypothetical protein
Query= SwissProt::P80911 (196 letters) >NCBI__GCF_000422285.1:WP_051185090.1 Length = 192 Score = 99.4 bits (246), Expect = 4e-26 Identities = 58/189 (30%), Positives = 101/189 (53%), Gaps = 16/189 (8%) Query: 4 NIYVCGVGGQGIIKTSVIIGEAAMNEGMNVVMSEIHGMAQRGGAVSTEIRFGDVRGSIIP 63 NI + G+GGQGI+ + ++ +A++ +G V+ +E HGMAQRGG+V + +R G V S++P Sbjct: 10 NIVLSGLGGQGILFMTKLLAQASLAKGFEVMGAETHGMAQRGGSVVSHLRLGPVHSSLVP 69 Query: 64 QGEADLVIAFEPLEALRALPKMSEDACVIVN--TSKIPPFNLIKSPHPYPPLEEIIKTLE 121 +G+A ++A + E R LP + + ++ +S I P E+ L+ Sbjct: 70 EGKAHFLLALDESEGYRTLPFLRPAGRLYLDAPSSSIRP--------------EVQAYLD 115 Query: 122 ENAGRVRSFNGEKIAVEAGHILSLNMVMLGAAAATTGFPLGEETLIESMKNNLPPKLMEV 181 R+F +K A++ G LS N+ +LG +A P+G L +++ P +L + Sbjct: 116 RLGAVCRAFPAQKTAMDLGAPLSTNLALLGFFSAFESAPIGHAELRATVEAASPERLKDA 175 Query: 182 NLRAFHEGF 190 NL F G+ Sbjct: 176 NLSVFDAGY 184 Lambda K H 0.317 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 94 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 196 Length of database: 192 Length adjustment: 20 Effective length of query: 176 Effective length of database: 172 Effective search space: 30272 Effective search space used: 30272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory