Align Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; EC 2.3.1.168; Branched-chain alpha-keto acid dehydrogenase complex component E2; BCKAD-E2; BCKADE2; Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; Dihydrolipoamide branched chain transacylase; Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (uncharacterized)
to candidate WP_051242708.1 H537_RS43315 hypothetical protein
Query= curated2:P09062 (423 letters) >NCBI__GCF_000430725.1:WP_051242708.1 Length = 392 Score = 149 bits (376), Expect = 1e-40 Identities = 122/401 (30%), Positives = 194/401 (48%), Gaps = 57/401 (14%) Query: 28 GDIIAEDQVVADVMTDKATVEIPSPVSGKVLALGGQPGEVMAVGSELIRIEVEGSGNHVD 87 GD + DQ + V +D ++E+P+ +G+V +L Q G+ + + I+ + S V Sbjct: 27 GDGVGADQPLLLVESDALSLELPAGCTGRVKSLHVQAGDAVQPNALFAIIDEDAS---VQ 83 Query: 88 VPQAKPAEVPAAPVAAKPEPQKDVKPAAYQASASHEAAPIVPRQPGDKPLASPAVRKRAL 147 + A PA V A V+A P+P A +AA + P A+P++R+RA Sbjct: 84 ITAA-PAPVQAPVVSAPPQP------------AVCDAALL--------PHATPSMRQRAR 122 Query: 148 DAGIELRYVHGSGPAGRILHEDLDAFMSKPQSAAGQTPNG-----YARRTDSEQVPVIGL 202 + G+ + + P +AA + G + + S PV Sbjct: 123 ELGVPVA-----------------GLATSPAAAAAPSRGGLDVLPWPKVDHSRFGPVQRQ 165 Query: 203 RRKIAQRMQDAKRR-----VAHFSYVEEIDVTALEALRQQLNSKHG----DSRGKLTLLP 253 R Q++ A + H + + D+T LEA R++LN S K+TLL Sbjct: 166 PRSRVQKISAANLHRNWVVIPHVTNQDLADITELEAYRRRLNQAPAVEGTSSPTKVTLLA 225 Query: 254 FLVRALVVALRDFPQINATYDDEAQIITRHGAVHVGIATQGDNGLMVPVLRHAEAGSLWA 313 FLV+A V AL+ +PQ NA+ D + ++ ++ H+G A +GLMVPV+ A S+ Sbjct: 226 FLVKAAVAALKAYPQFNASLDGDDLVLKQY--YHIGFAADTPHGLMVPVIFDANRKSVLE 283 Query: 314 NAGEISRLANAARNNKASREELSGSTITLTSLGALGGIVSTPVVNTPEVAIVGVNRMVER 373 A E++ L +AR + ++SG +++SLG +G TP++N PEVAI+GV + Sbjct: 284 IAAEVATLVASAREGRLKPAQMSGGCFSISSLGGIGSTSFTPIINAPEVAILGVCPSSWQ 343 Query: 374 PVVIDGQIVVRKMMNLSSSFDHRVVDGMDAALFIQAVRGLL 414 P V R M+ LS S+DHRVVDG AA F+ + LL Sbjct: 344 PRCDGQAFVPRLMLPLSLSWDHRVVDGAAAARFLGHIARLL 384 Lambda K H 0.316 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 423 Length of database: 392 Length adjustment: 31 Effective length of query: 392 Effective length of database: 361 Effective search space: 141512 Effective search space used: 141512 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory