Align L-fuculose phosphate aldolase; EC 4.1.2.17; L-fuculose-1-phosphate aldolase (uncharacterized)
to candidate WP_051305233.1 G494_RS0100585 fuculose phosphate aldolase
Query= curated2:Q8FEF0 (215 letters) >NCBI__GCF_000429965.1:WP_051305233.1 Length = 200 Score = 183 bits (465), Expect = 2e-51 Identities = 92/198 (46%), Positives = 130/198 (65%), Gaps = 6/198 (3%) Query: 17 MTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDGNG-----KHEEGKLPS 71 M + GLNQGT+GN+SVR LITP+ +PYE+ + +V +D G + + PS Sbjct: 1 MNQSGLNQGTSGNISVRCGRDFLITPSALPYEQCGPADMVRLDMAGAPQDRRQSSSRRPS 60 Query: 72 SEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGGNSIPCAPYATF 131 SEWR H YQ+RP+A A++H+H++ CT ++ L + IP HYM+A AGG+SIPCAPYA F Sbjct: 61 SEWRLHRDLYQARPEAGAILHSHSIWCTVLACLEKEIPPFHYMVAVAGGDSIPCAPYALF 120 Query: 132 GTRELSEHVALALKNRKATLLQHHGLIACEANLEKALWLAHEVEVLAQLYLTTLAITDPV 191 G++ELS+ + + R+A LL HHG++ A LE+ + LA EVE LA++Y L I +P Sbjct: 121 GSQELSDRLLATIGQRRACLLAHHGMVCYAAELEQLIPLATEVETLARMYGQALQIAEP- 179 Query: 192 PVLSDEEIAVVLEKFKTY 209 P LS E+A VL +F Y Sbjct: 180 PRLSRMEMAAVLGRFADY 197 Lambda K H 0.319 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 215 Length of database: 200 Length adjustment: 21 Effective length of query: 194 Effective length of database: 179 Effective search space: 34726 Effective search space used: 34726 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory