Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate WP_051305489.1 G494_RS0107330 inner-membrane translocator
Query= uniprot:A0A1N7UKA9 (325 letters) >NCBI__GCF_000429965.1:WP_051305489.1 Length = 383 Score = 237 bits (605), Expect = 3e-67 Identities = 141/379 (37%), Positives = 214/379 (56%), Gaps = 61/379 (16%) Query: 7 TAPVTAAPRNRLRLSLDRFGLPLVFILLCVVMAFSSEYFMTWRNWMDILRQTSINGILAV 66 TA +A P + + L G + + L ++ + E F T RN ++ RQT+I GI++V Sbjct: 3 TAVNSANPFHHVAGFLKENGTLVALVALALIFSLMDEAFFTPRNLTNLARQTTIIGIISV 62 Query: 67 GMTYVILTKGIDLSVGSILAFAGLCSAMVATQGYGLLAAVSAGMF-AGAMLGVVNGFMVA 125 GMT VI+ GIDLSVGSI+ + + ++ QG + A+ + G ++G+ NGF +A Sbjct: 63 GMTMVIIINGIDLSVGSIVGLSAIVVTLLMQQGMNVWLAIPLTLLTTGTLIGLWNGFWIA 122 Query: 126 NLSIPPFVATLGMLSIARGMTFILNDGS--PITD----------LPDAYLAL-------- 165 + +IPPF+ TLGM++IARG+ L++GS P+TD +P A + Sbjct: 123 HYNIPPFIITLGMMTIARGLALTLSNGSSVPVTDPIFPQLGGSYIPPAVSGILIILTLSL 182 Query: 166 ----------------GIGKIGPI----------------------GVP--IIIFAVVAL 185 + K+ P+ G+P + +F+++A Sbjct: 183 FIFALFREVGQRRKYGAVVKLQPLIASTLITVVGLGLSFYVFTTYRGIPYPVAVFSIIAF 242 Query: 186 IFWMVLRYTTYGRYVYAVGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSARTTS 245 I +L T +GR +YA+GGNE++AR SGI + +V VY + LA L+GV+L++R Sbjct: 243 IGIFMLNNTIFGRRIYAIGGNEEAARLSGIRIYRVKLIVYSIITTLAALSGVLLASRLNG 302 Query: 246 ALPQAGVSYELDAIAAVVIGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLGVSSYYQQV 305 A P G +ELDAI+AV+IGGTS SGG G+I GT+ GA +IG++NNG++LLGV ++YQ + Sbjct: 303 ASPNLGNMFELDAISAVIIGGTSFSGGVGTISGTVIGAFIIGILNNGMSLLGVPTFYQLI 362 Query: 306 AKGLIIVFAVLIDVWRKKK 324 KGLII+ AV DV KKK Sbjct: 363 IKGLIIILAVWFDVLNKKK 381 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 325 Length of database: 383 Length adjustment: 29 Effective length of query: 296 Effective length of database: 354 Effective search space: 104784 Effective search space used: 104784 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory