Protein WP_051305668.1 in Desulfobulbus mediterraneus DSM 13871
Annotation: NCBI__GCF_000429965.1:WP_051305668.1
Length: 263 amino acids
Source: GCF_000429965.1 in NCBI
Candidate for 28 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-histidine catabolism | Ac3H11_2554 | lo | ABC transporter for L-Histidine, permease component 1 (characterized) | 39% | 91% | 145.6 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| D-glucosamine (chitosamine) catabolism | AO353_21715 | lo | ABC transporter for D-Glucosamine, permease component 2 (characterized) | 38% | 90% | 139 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-arginine catabolism | artM | lo | ABC transporter for L-Arginine, permease component 2 (characterized) | 31% | 95% | 129.8 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-lysine catabolism | hisM | lo | Amino acid ABC transporter, membrane protein (characterized, see rationale) | 35% | 89% | 117.5 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-asparagine catabolism | peb1D | lo | Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) | 34% | 93% | 116.7 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-aspartate catabolism | peb1D | lo | Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) | 34% | 93% | 116.7 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-histidine catabolism | BPHYT_RS24010 | lo | Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale) | 33% | 82% | 115.5 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-glutamate catabolism | gltK | lo | Amino acid ABC transporter membrane protein, component of Amino acid transporter, AatJMQP. Probably transports L-glutamic acid, D-glutamine acid, L-glutamine and N-acetyl L-glutamic acid (Johnson et al. 2008). Very similar to 3.A.1.3.19 of P. putida (characterized) | 37% | 87% | 110.9 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-histidine catabolism | aapM | lo | ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 2 (characterized) | 33% | 51% | 110.9 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| D-glucosamine (chitosamine) catabolism | AO353_21720 | lo | ABC transporter for D-Glucosamine, permease component 1 (characterized) | 31% | 97% | 110.2 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-asparagine catabolism | aatQ | lo | Glutamate/aspartate import permease protein GltJ (characterized) | 31% | 96% | 109.8 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-aspartate catabolism | aatQ | lo | Glutamate/aspartate import permease protein GltJ (characterized) | 31% | 96% | 109.8 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-glutamate catabolism | gltJ | lo | Glutamate/aspartate import permease protein GltJ (characterized) | 31% | 96% | 109.8 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-asparagine catabolism | aatM | lo | ABC transporter for L-Asparagine and possibly other L-amino acids, permease component 2 (characterized) | 34% | 93% | 108.2 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-aspartate catabolism | aatM | lo | ABC transporter for L-Asparagine and possibly other L-amino acids, permease component 2 (characterized) | 34% | 93% | 108.2 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-asparagine catabolism | peb1B | lo | PEP1B, component of Uptake system for glutamate and aspartate (characterized) | 30% | 76% | 107.5 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-aspartate catabolism | peb1B | lo | PEP1B, component of Uptake system for glutamate and aspartate (characterized) | 30% | 76% | 107.5 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-glutamate catabolism | peb1B | lo | PEP1B, component of Uptake system for glutamate and aspartate (characterized) | 30% | 76% | 107.5 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| D-alanine catabolism | Pf6N2E2_5404 | lo | ABC transporter for D-Alanine, permease component 1 (characterized) | 30% | 56% | 103.6 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-arginine catabolism | artQ | lo | arginine/ornithine transport protein (characterized) | 32% | 93% | 103.2 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-citrulline catabolism | AO353_03050 | lo | ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized) | 33% | 93% | 103.2 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-asparagine catabolism | aapQ | lo | AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 31% | 67% | 95.1 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-aspartate catabolism | aapQ | lo | AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 31% | 67% | 95.1 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-glutamate catabolism | aapQ | lo | AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 31% | 67% | 95.1 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-histidine catabolism | aapQ | lo | AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 31% | 67% | 95.1 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-leucine catabolism | aapQ | lo | AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 31% | 67% | 95.1 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-proline catabolism | aapQ | lo | AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 31% | 67% | 95.1 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
| L-lysine catabolism | hisQ | lo | Amino acid ABC transporter, membrane protein (characterized, see rationale) | 31% | 88% | 92 | Basic amino acid uptake transporter, BgtAB | 43% | 156.4 |
Sequence Analysis Tools
View WP_051305668.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MKPAPLFKTVYRDLLGFAALLALGFWLIGRGGANISYRWHWQQVPQYLYSLEDGRFIAGP
LLQGLMVTLEITAVSLILAGCIGLATALLRMSSSPVGRILAWGYLETIRNTPLLVQIFFL
YFVMAPILDIGRFATAVVALSMFEGAYASEIFRAGITSLAKGQWEAAFSLGLTRFDTYRK
VILPQAIRRILPPLTSQAISLVKDSALVSTIAVYDLTMEGRAIIAETFMTFEIWFTVAAI
YLSVTLLLSGLVALVERYYPQRS
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory