Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_051335598.1 METAC_RS0114660 polyamine ABC transporter ATP-binding protein
Query= TCDB::Q8DQH8 (254 letters) >NCBI__GCF_000427445.1:WP_051335598.1 Length = 390 Score = 120 bits (301), Expect = 4e-32 Identities = 78/251 (31%), Positives = 127/251 (50%), Gaps = 20/251 (7%) Query: 3 LLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTVTL 62 ++ ++ +TK G LTAV +++L L GE L+GP+G GKT+L L+ G P G + + Sbjct: 32 VVRLEGVTKRHGRLTAVDNLSLSLRRGEFFALLGPSGCGKTSLLRLIGGFEAPDSGRIFI 91 Query: 63 DGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLPAFY 122 DG + P++ + FQ LF L V N I FG L Sbjct: 92 DGVDVTETPPHRRP---VNMMFQTYALFPHLNVACN--IGFG-------------LVQEG 133 Query: 123 KSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPAAGM 182 + ++K + E+L+ L+G E LS GQ++R+ + RALA PK+L LDEP A + Sbjct: 134 MPKAKIKTRVEEMLRFVQLEGLGERRPDQLSGGQKQRVALARALAKRPKLLLLDEPLAAL 193 Query: 183 NPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEI--K 240 + + E + R++ F +T +++ HD M + RI V+ GR+ GTP++I Sbjct: 194 DRRLREETQFELMRLQKTFGVTFLVVTHDQREAMAMAGRIAVMREGRIEQIGTPEQIYET 253 Query: 241 TNKRVIEAYLG 251 + R + ++G Sbjct: 254 PSSRYVARFVG 264 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 390 Length adjustment: 27 Effective length of query: 227 Effective length of database: 363 Effective search space: 82401 Effective search space used: 82401 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory