Align C4-dicarboxylate TRAP transporter small permease protein DctQ (characterized)
to candidate WP_051378244.1 H566_RS23370 TRAP transporter small permease
Query= SwissProt::O07837 (227 letters) >NCBI__GCF_000482785.1:WP_051378244.1 Length = 208 Score = 234 bits (598), Expect = 7e-67 Identities = 119/199 (59%), Positives = 142/199 (71%), Gaps = 24/199 (12%) Query: 1 MLRILDRAEEVLIAALIATATVLIFVSVTHRF--TLGFVADFVGFFRGHGMTGAAAAAKS 58 +L++LDR EE +IA+L+A AT++IFV+V HR+ T+ DF Sbjct: 2 VLKLLDRLEETIIASLMALATLVIFVAVVHRYLSTVELTQDF------------------ 43 Query: 59 LYTTLRGINLVWAQELCIILFVWMAKFGAAYGVRTGIHVGIDVLINRLDAPKRRFFILLG 118 + INL WAQELCI +FVWMAKFGAAYGVRTGIHVG+DVLINRL R F++ G Sbjct: 44 ----MLSINLSWAQELCIYMFVWMAKFGAAYGVRTGIHVGVDVLINRLPPKGRNGFVVFG 99 Query: 119 LGAGALFTGIIATLGANFVLHMYHASSTSPDLELPMWLVYLAIPMGSSLMCFRFLQVAFG 178 L AGALFTGI+ TLGANFV HM TS D+E+PMW+VYLAIP+GS LMCFRFLQVA Sbjct: 100 LLAGALFTGIVGTLGANFVWHMAGTDQTSADMEVPMWIVYLAIPLGSYLMCFRFLQVAVQ 159 Query: 179 FARTGELPHHDHGHVDGVD 197 F RTGELPHHDH HV+G+D Sbjct: 160 FVRTGELPHHDHSHVEGID 178 Lambda K H 0.328 0.143 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 227 Length of database: 208 Length adjustment: 22 Effective length of query: 205 Effective length of database: 186 Effective search space: 38130 Effective search space used: 38130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory