Align MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized)
to candidate WP_051378268.1 H566_RS23460 ABC transporter ATP-binding protein
Query= TCDB::O30494 (367 letters) >NCBI__GCF_000482785.1:WP_051378268.1 Length = 365 Score = 342 bits (878), Expect = 7e-99 Identities = 189/370 (51%), Positives = 248/370 (67%), Gaps = 29/370 (7%) Query: 1 MANLKIKNLQKGFEGFSIIKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSEGTI 60 M+ L+++ ++K F IKG++L + EFVVFVGPSGCGKSTLLR+IAGL E+ G + Sbjct: 1 MSFLQLRGVEKFFGEHRAIKGVNLTIEKGEFVVFVGPSGCGKSTLLRMIAGLTEIDGGEL 60 Query: 61 ELDGRDITEVTPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVDKQLVESKVNEAARI 120 LD R+IT + +KRDLAMVFQ+YALYPHMSV NMSFAL LA VD+Q ++ KV AARI Sbjct: 61 VLDNREITRLPSSKRDLAMVFQSYALYPHMSVYDNMSFALRLAKVDRQTIDEKVQRAARI 120 Query: 121 LELGPLLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELARLH 180 L L L+R P++LSGGQRQRVAIGRAIVR PK+FLFDEPLSNLDAALR Q R+E+ +LH Sbjct: 121 LNLAQYLQRTPRELSGGQRQRVAIGRAIVRAPKVFLFDEPLSNLDAALRGQTRIEIHKLH 180 Query: 181 KELQATMIYVTHDQVEAMTLADKVVVLNSGRIEQVGSPLELYHQPANLFVAGFLGTPKMG 240 ++L AT IYVTHDQVEAMTLAD+VVVL G+IEQVG+PLELY +PAN FVA F+GTP+M Sbjct: 181 RDLGATTIYVTHDQVEAMTLADRVVVLRDGQIEQVGTPLELYDRPANRFVAQFIGTPQMN 240 Query: 241 FLKGKVTRVDGQGCEVQLDAGTLISLPLSGASLSVGSAVT----LGIRPEHLEIASPGQT 296 L + L +VG+ T +G+RPE + + PGQ Sbjct: 241 ILDTR---------------------DLPALDAAVGAPDTHDGFVGLRPETVLMREPGQG 279 Query: 297 TLTVTADVGERLGSDTFCHVITSNGEPLTMRIRGDMASQY----GETLHLHLDPAHCHLF 352 L+ ++ E LG++T +V + +++ D ++ G+ + + + P HLF Sbjct: 280 RLSGRVELVESLGANTLIYVQVDHPGRAPVQLVADQPTRTGLHPGDLVGIDIAPGAAHLF 339 Query: 353 DTDGVAVAVP 362 D +G A+A P Sbjct: 340 DREGRALAAP 349 Lambda K H 0.319 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 365 Length adjustment: 30 Effective length of query: 337 Effective length of database: 335 Effective search space: 112895 Effective search space used: 112895 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory