Align Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_051378268.1 H566_RS23460 ABC transporter ATP-binding protein
Query= uniprot:A0A165KQ08 (355 letters) >NCBI__GCF_000482785.1:WP_051378268.1 Length = 365 Score = 292 bits (748), Expect = 8e-84 Identities = 162/353 (45%), Positives = 226/353 (64%), Gaps = 19/353 (5%) Query: 3 SSLDIAGINKRFGKGDKSVEVLRKVDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEPTE 62 S L + G+ K FG+ ++ V++ + GEF++ VGPSGCGKSTLL +IAGL E Sbjct: 2 SFLQLRGVEKFFGEH----RAIKGVNLTIEKGEFVVFVGPSGCGKSTLLRMIAGLTEIDG 57 Query: 63 GEIRIGGKNVVGMPPRDRDIAMVFQSYALYPTLSVADNIGFALEMRKMPKPERQKRIDEV 122 GE+ + + + +P RD+AMVFQSYALYP +SV DN+ FAL + K+ + +++ Sbjct: 58 GELVLDNREITRLPSSKRDLAMVFQSYALYPHMSVYDNMSFALRLAKVDRQTIDEKVQRA 117 Query: 123 AAMLQISHLLDRRPSQLSGGQRQRVAMGRALARQPQLFLFDEPLSNLDAKLRVEMRAEIK 182 A +L ++ L R P +LSGGQRQRVA+GRA+ R P++FLFDEPLSNLDA LR + R EI Sbjct: 118 ARILNLAQYLQRTPRELSGGQRQRVAIGRAIVRAPKVFLFDEPLSNLDAALRGQTRIEIH 177 Query: 183 RLHQASGITSVYVTHDQVEAMTLGSRIAVMKGGVVQQLGTPDEIYNRPANTYVATFIGSP 242 +LH+ G T++YVTHDQVEAMTL R+ V++ G ++Q+GTP E+Y+RPAN +VA FIG+P Sbjct: 178 KLHRDLGATTIYVTHDQVEAMTLADRVVVLRDGQIEQVGTPLELYDRPANRFVAQFIGTP 237 Query: 243 TMNLLRGAVTGGQFGIQGAALNLAPPPSSANEVLLGVRPEHLVMQETAPWR--GRVSVVE 300 MN+L AL+ A ++ +G+RPE ++M+E R GRV +VE Sbjct: 238 QMNILDTR--------DLPALDAAVGAPDTHDGFVGLRPETVLMREPGQGRLSGRVELVE 289 Query: 301 PTGPDT--YVMVD-TAAGSVTLRTDAQTR--VQPGEHVGLALAPAHAHWFDAQ 348 G +T YV VD V L D TR + PG+ VG+ +AP AH FD + Sbjct: 290 SLGANTLIYVQVDHPGRAPVQLVADQPTRTGLHPGDLVGIDIAPGAAHLFDRE 342 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 365 Length adjustment: 29 Effective length of query: 326 Effective length of database: 336 Effective search space: 109536 Effective search space used: 109536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory