Align acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10); propanal dehydrogenase (CoA-propanoylating) (EC 1.2.1.87) (characterized)
to candidate WP_051378750.1 H566_RS24935 acetaldehyde dehydrogenase (acetylating)
Query= BRENDA::Q79AF6 (304 letters) >NCBI__GCF_000482785.1:WP_051378750.1 Length = 329 Score = 504 bits (1299), Expect = e-148 Identities = 246/294 (83%), Positives = 274/294 (93%) Query: 3 KKIKCALIGPGNIGTDLLAKLQRSPVLEPIWMVGIDPESDGLKRAREMGIKTTADGVDGL 62 KKIKCALIGPGNIGTDLL KL+RSPVLEP+WMVGIDP+S+GL RARE+G+KTTADGVDGL Sbjct: 2 KKIKCALIGPGNIGTDLLYKLRRSPVLEPVWMVGIDPQSEGLARARELGLKTTADGVDGL 61 Query: 63 IPHMQADGVQIVFDATSAYVHADNSRKVNALGALMIDLTPAAIGPFCVPTVNLKEHVGKG 122 +PH+ DG+QI FDATSAYVHA+NSRK+NALG LMIDLTPAAIGPFCVP VNL++HVG G Sbjct: 62 LPHVAEDGIQIAFDATSAYVHAENSRKLNALGVLMIDLTPAAIGPFCVPPVNLRDHVGSG 121 Query: 123 EMNVNMVTCGGQATIPMVAAVSRVQPVAYGEIVATVSSKSAGPGTRKNIDEFTRTTAGAV 182 EMNVNMVTCGGQATIPMVAAVSRVQ V YGEIVATVSS+S GPGTRKNIDEFTRTTAGAV Sbjct: 122 EMNVNMVTCGGQATIPMVAAVSRVQTVDYGEIVATVSSRSVGPGTRKNIDEFTRTTAGAV 181 Query: 183 EKVGGAKKGKAIIILNPAEPPLIMRDTVHCLLESEPDQAKITESIHAMIKEVQKYVPGYK 242 E+VGGA GKAIII+NPA+PPLIMRDTVHCL +EPD+ IT S+ AMI+EV++YVPGY+ Sbjct: 182 ERVGGAATGKAIIIINPADPPLIMRDTVHCLTAAEPDREAITASVLAMIEEVRRYVPGYR 241 Query: 243 LVNGPVFDGLRVSVYLEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEEILAGQ 296 LVNGPVFDG RVS+++EVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEEILAG+ Sbjct: 242 LVNGPVFDGNRVSMFMEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEEILAGR 295 Lambda K H 0.317 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 329 Length adjustment: 27 Effective length of query: 277 Effective length of database: 302 Effective search space: 83654 Effective search space used: 83654 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate WP_051378750.1 H566_RS24935 (acetaldehyde dehydrogenase (acetylating))
to HMM TIGR03215 (acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03215.hmm # target sequence database: /tmp/gapView.32587.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03215 [M=285] Accession: TIGR03215 Description: ac_ald_DH_ac: acetaldehyde dehydrogenase (acetylating) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-145 470.4 0.5 1.2e-145 470.1 0.5 1.0 1 lcl|NCBI__GCF_000482785.1:WP_051378750.1 H566_RS24935 acetaldehyde dehydr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000482785.1:WP_051378750.1 H566_RS24935 acetaldehyde dehydrogenase (acetylating) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 470.1 0.5 1.2e-145 1.2e-145 1 284 [. 3 292 .. 3 293 .. 0.98 Alignments for each domain: == domain 1 score: 470.1 bits; conditional E-value: 1.2e-145 TIGR03215 1 kvkvaiiGsGnigtdllikllrsevlelallvGidpesdGlararelgvetsaeGvdalleee...did 66 k+k+a+iG+Gnigtdll+kl rs vle++++vGidp+s+Glararelg++t+a+Gvd+ll + i+ lcl|NCBI__GCF_000482785.1:WP_051378750.1 3 KIKCALIGPGNIGTDLLYKLRRSPVLEPVWMVGIDPQSEGLARARELGLKTTADGVDGLLPHVaedGIQ 71 79**********************************************************98877689* PP TIGR03215 67 ivfdatsakahaenaklleelgkividltPaavGpyvvPavnleevldak..nvnlvtCgGqatiPiva 133 i+fdatsa++haen+++l++lg+ +idltPaa+Gp++vP+vnl++++ + nvn+vtCgGqatiP+va lcl|NCBI__GCF_000482785.1:WP_051378750.1 72 IAFDATSAYVHAENSRKLNALGVLMIDLTPAAIGPFCVPPVNLRDHVGSGemNVNMVTCGGQATIPMVA 140 **********************************************976556***************** PP TIGR03215 134 avsrvakvkyaeivasiasksaGpgtranideftettskaleqvgGakkgkaiiilnPaePpllmrdtv 202 avsrv++v y+eiva+++s+s+Gpgtr+nideft+tt+ a+e+vgGa+ gkaiii+nPa+Ppl+mrdtv lcl|NCBI__GCF_000482785.1:WP_051378750.1 141 AVSRVQTVDYGEIVATVSSRSVGPGTRKNIDEFTRTTAGAVERVGGAATGKAIIIINPADPPLIMRDTV 209 ********************************************************************* PP TIGR03215 203 yalv.eeadeeaieasveemveevqkyvpGyrlkqevvldgekvsvlleveGagdylPkyaGnldilta 270 ++l+ +e+d+eai+asv +m+eev++yvpGyrl++ +v+dg++vs+++eveG gdylPkyaGnldi+ta lcl|NCBI__GCF_000482785.1:WP_051378750.1 210 HCLTaAEPDREAITASVLAMIEEVRRYVPGYRLVNGPVFDGNRVSMFMEVEGLGDYLPKYAGNLDIMTA 278 ***9899************************************************************** PP TIGR03215 271 aalavaeklaeell 284 aa+++ae++aee+l lcl|NCBI__GCF_000482785.1:WP_051378750.1 279 AAARTAEMFAEEIL 292 **********9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (329 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 12.34 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory