GapMind for catabolism of small carbon sources

 

Protein WP_051678429.1 in Thiomicrospira pelophila DSM 1534

Annotation: NCBI__GCF_000711195.1:WP_051678429.1

Length: 223 amino acids

Source: GCF_000711195.1 in NCBI

Candidate for 77 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism Ac3H11_2560 med ABC transporter for L-Histidine, ATPase component (characterized) 41% 75% 141 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
putrescine catabolism potA lo PotG aka B0855, component of Putrescine porter (characterized) 45% 55% 177.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 46% 56% 175.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-maltose catabolism malK lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 45% 56% 172.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 43% 58% 171 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 44% 62% 167.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 44% 62% 167.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 41% 58% 165.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 41% 58% 165.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 44% 61% 163.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 43% 60% 163.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 42% 62% 162.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 43% 54% 162.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 44% 57% 161.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 44% 57% 161.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 44% 57% 161.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 43% 53% 160.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 40% 57% 157.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 42% 59% 157.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 42% 59% 157.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 42% 59% 157.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 42% 59% 157.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 42% 59% 157.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 42% 59% 157.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 42% 59% 157.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 42% 59% 157.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 41% 54% 156.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 43% 54% 154.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 43% 54% 154.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 43% 54% 154.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 43% 54% 154.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 43% 54% 154.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 43% 54% 154.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 55% 152.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 55% 152.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 55% 152.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 55% 152.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 55% 152.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 55% 152.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 38% 57% 152.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 38% 57% 152.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 38% 57% 152.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 38% 57% 152.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 42% 54% 152.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 53% 152.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 43% 52% 151.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 39% 55% 151.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 40% 55% 151.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 39% 57% 149.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 38% 55% 146.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 39% 54% 145.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 40% 54% 141.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 40% 54% 141.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 39% 53% 138.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 40% 64% 137.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-glutamate catabolism gltL lo GluA aka CGL1950, component of Glutamate porter (characterized) 37% 85% 134 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-proline catabolism opuBA lo BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 37% 66% 132.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-asparagine catabolism aatP lo PP1068, component of Acidic amino acid uptake porter, AatJMQP (characterized) 36% 85% 132.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-aspartate catabolism aatP lo PP1068, component of Acidic amino acid uptake porter, AatJMQP (characterized) 36% 85% 132.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 38% 78% 131 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 38% 78% 131 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 37% 87% 129.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 37% 87% 129.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 38% 79% 128.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 35% 81% 122.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 36% 50% 102.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-alanine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 94% 101.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-isoleucine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 94% 101.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-leucine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 94% 101.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-serine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 94% 101.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-threonine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 94% 101.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-valine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 94% 101.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
L-phenylalanine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 30% 88% 92.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-fructose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 30% 79% 86.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-mannose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 30% 79% 86.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
D-ribose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 30% 79% 86.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9
sucrose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 30% 79% 86.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 52% 219.9

Sequence Analysis Tools

View WP_051678429.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MLKISDIQVVYNQTPVLDQFNLDISAGEIVGILGPSGCGKSTLLRAIAGFVEIAKGEICL
NNDCLASCQCTIPPEKRGVGMVFQDNALFPHLTVEENIAFGLNKMPKAERKTRVAELIEL
IQLQGLEQRYPHELSGGQQQRVALARALAPRPSLILFDEPFSNLDTTLSEHLAIEIRQLL
KQQNTSAILVTHTFREAELMCDRYGTLESCLLGNAEWQHTNAA

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory