Align ABC transporter substrate-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_051954093.1 Q392_RS29775 ABC transporter substrate-binding protein
Query= TCDB::Q8DQI1 (386 letters) >NCBI__GCF_000745855.1:WP_051954093.1 Length = 389 Score = 82.4 bits (202), Expect = 2e-20 Identities = 63/206 (30%), Positives = 94/206 (45%), Gaps = 2/206 (0%) Query: 32 AGNSVEEKTIKIGFNFEESGSLAAYGTAEQKGAQLAVDEINAAGGIDGKQIEVVDKDNKS 91 A N V + TI++G + SG +G + G QL+ D IN AGG++G++IE+V D+ Sbjct: 32 AANGVSDDTIRLGQSAVFSGPAQDFGVDYRAGIQLSFDRINKAGGVNGRRIELVSHDDVY 91 Query: 92 ETAEAASVTTNLVTQSKVSAVVGPATSGATAAAVANATKAGVPLISP-SATQDGLTKGQD 150 E A+ A TT L+ Q KV A+ G +G AAA+ KAGVP+ +P T T Sbjct: 92 EPAKTAVNTTRLIEQDKVFALTGYVATGNLAAAMPLCEKAGVPMFAPLVGTTSFRTSVNR 151 Query: 151 YLF-IGTFQDSFQGKIISNYVSEKLNAKKVVLYTDNASDYAKGIAKSFRESYKGEIVADE 209 LF + D KIIS+ + + VV + YK +V Sbjct: 152 LLFHVRAGYDLELRKIISHLSTIGIRNIAVVFQDSAFGTSNLATCEQLAAEYKVPVVKKL 211 Query: 210 TFVAGDTDFQAALTKMKGKDFDAIVV 235 + TD + +K A+V+ Sbjct: 212 SMAIAATDAKEVAAGLKAAAPGAVVM 237 Lambda K H 0.310 0.126 0.337 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 389 Length adjustment: 30 Effective length of query: 356 Effective length of database: 359 Effective search space: 127804 Effective search space used: 127804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory