Align branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) (characterized)
to candidate WP_052300666.1 BTUS_RS15295 branched-chain amino acid ABC transporter permease
Query= ecocyc::LIVH-MONOMER (308 letters) >NCBI__GCF_000092905.1:WP_052300666.1 Length = 304 Score = 215 bits (547), Expect = 1e-60 Identities = 110/303 (36%), Positives = 186/303 (61%), Gaps = 6/303 (1%) Query: 6 LYFLQQMFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVSFMIIAALMMMG 65 ++ Q + NGVT+GS YAL+A+GYT+VY ++NFA GE YM+G++ + + A+ Sbjct: 8 MFIFQNVINGVTIGSIYALMALGYTLVYSASRLVNFAQGEGYMLGAFATLFALVAVPEQS 67 Query: 66 IDTGWLLVAAGFVGAIVIASAYGWSIERVAYRPVRNSKRLIALISAIGMSIFLQNYVSLT 125 ++ A V A+V A GW+ ER +RP+RN+ I +++++G++I ++N V Sbjct: 68 --PAFVRAIASGVAAMVAAVLLGWATERFVFRPLRNAPPFIPVMASLGLAIAIENTVLNL 125 Query: 126 EGSRDVALPSLFNGQWVVGHSENFSASITTMQAVIWIVTFLAMLALTIFIRYSRMGRACR 185 G+ +P+L W + + ++ +Q V+ V L M+ L F+R + G+A R Sbjct: 126 FGAGFNNVPAL----WPLTGIQMADVRMSYVQLVMLSVAVLLMVLLDRFLRSTLPGKALR 181 Query: 186 ACAEDLKMASLLGINTDRVIALTFVIGAAMAAVAGVLLGQFYGVINPYIGFMAGMKAFTA 245 A A+D A L+GI+T+ +AL FV+ A ++ V+G + +YG +N Y+GF AG+ F A Sbjct: 182 AVAQDPTAARLMGISTEAAVALVFVVAAGLSGVSGYFVALYYGSVNFYMGFQAGINGFAA 241 Query: 246 AVLGGIGSIPGAMIGGLILGIAEALSSAYLSTEYKDVVSFALLILVLLVMPTGILGRPEV 305 A+ GG G++ GA++GG++LGI EA S+ + E+K V+++ LL+LV+L+ P GI G Sbjct: 242 AIFGGFGNVKGAIVGGILLGIFEAFGSSLVPAEWKGVIAYVLLLLVILIRPQGIFGEALP 301 Query: 306 EKV 308 E++ Sbjct: 302 ERL 304 Lambda K H 0.328 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 304 Length adjustment: 27 Effective length of query: 281 Effective length of database: 277 Effective search space: 77837 Effective search space used: 77837 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory