Align Branched chain amino acid ABC transporter substrate-binding protein (characterized, see rationale)
to candidate WP_052300724.1 BTUS_RS06860 branched-chain amino acid ABC transporter substrate-binding protein
Query= uniprot:A0A165KTD4 (375 letters) >NCBI__GCF_000092905.1:WP_052300724.1 Length = 390 Score = 202 bits (513), Expect = 2e-56 Identities = 120/366 (32%), Positives = 193/366 (52%), Gaps = 14/366 (3%) Query: 14 AAAAGVASAQEQVVKIGHVAPVSGAQAHYGKDNENGARMAIEELNAQGVTIGGKKIKFEL 73 + + G V+KI +P+SG A G+ + GA++A+E+ +G +L Sbjct: 19 SGSGGGGGGSGGVIKIATQSPLSGGNATLGEAIKLGAQLAVEDRAEDFKKLG---FTLQL 75 Query: 74 VAEDDAADPKQGTAAAQKLC-DAKVAGVVGHLNSGTTIPASKVYNDCGIPHVTGAATNPN 132 V DD ADPK+G A AQ + D + GVVGHLNSG IP+S+VY IP V+ + T Sbjct: 76 VPYDDQADPKKGVANAQMIAADQDILGVVGHLNSGVAIPSSEVYEKYSIPMVSPSNTATQ 135 Query: 133 LTKPGYKTTFRIIANDNALGAGLAFYAVDTLKLKTVAIIDDRTAYGQGVADVFKKTATAK 192 +T G KT RI A D+ G A +AV L K + +I D+TAYGQG+AD FK A Sbjct: 136 VTDRGLKTVNRICARDDFQGPAGAKFAVQQLGAKKIFVIQDKTAYGQGLADAFKDAAQKL 195 Query: 193 GMKVVDEQFTTDKATDFMAILTAIKAKNPDAIFYGGMDPQGGPMLRQMEQLGMGNVKYFG 252 G ++V + T DF +L KAKNPD I++GG +GG +++Q G+ N+K+ G Sbjct: 196 GAEIVGYEGITVGEKDFNGVLNQAKAKNPDLIYFGGTYAEGGLIVKQARDKGL-NMKFMG 254 Query: 253 GDGICTSEIAKLAAGAKTLGNVICAEGGSSLAKMPGGTAWKAKYDAKYPNQFQVYSPYTY 312 GD + +S + ++A A + + + + K G W +Y+ K+ + + YS Y Y Sbjct: 255 GDALDSSSMVEIAGPA--IADTYYTSIAADVTKTDEGKKWAQRYEQKFGKKVESYSSYGY 312 Query: 313 DATFLIVDAMKRANSVD-------PKVYTPELAKSSFKGVTSTIAFEPNGEMKNPAITLY 365 D+ +++ A++ A D +V A ++G+ + + F+ G+ K + +Y Sbjct: 313 DSAMVLLKAIENAIQADGGKKPTREQVRDAVRAIQDYQGIVTKVGFDNKGDNKYAKVYVY 372 Query: 366 VYKDGK 371 ++ G+ Sbjct: 373 QFEPGQ 378 Lambda K H 0.315 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 390 Length adjustment: 30 Effective length of query: 345 Effective length of database: 360 Effective search space: 124200 Effective search space used: 124200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory