Align NatC, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_052664078.1 NITAL_RS00060 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8YY08 (377 letters) >NCBI__GCF_000969705.1:WP_052664078.1 Length = 329 Score = 121 bits (303), Expect = 3e-32 Identities = 66/172 (38%), Positives = 103/172 (59%), Gaps = 10/172 (5%) Query: 213 LMLVSLLVLAFVFWRLEYLVRSPWGRVLKAIREDEEIPKAMGKNVFWYKLQSLMLGGAIA 272 L+ V+ ++A + +RSPWGRVLKAIRE+E+ ++GK+V+ YK+QSL+ GG I Sbjct: 157 LLTVAWGLVALTSLSVWLTMRSPWGRVLKAIREEEDAATSLGKSVYAYKMQSLIYGGVIG 216 Query: 273 GIAGAFFAWQISAIYPDNFQPQLTFDSWIMVILGGAGNNIGSILGAVIY---------FA 323 + G A ++ PD + +TF +++ +ILGG G +LG++I+ F Sbjct: 217 ALGGMVLATSTQSVQPDTYSTPITFFAYLALILGGTARVFGPVLGSMIFWMVLSFTDNFL 276 Query: 324 YDAITREVLPKIIPLDEARLGAFRIMCIGLILMVLMIWRPQGILGKKEELTL 375 AI+ +P I + ++G R M +GL LM+LMI+RPQGILG + E+ L Sbjct: 277 RQAISAGHIPTSI-MSGTQVGQVRFMLVGLGLMLLMIYRPQGILGDRREMEL 327 Lambda K H 0.328 0.145 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 433 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 377 Length of database: 329 Length adjustment: 29 Effective length of query: 348 Effective length of database: 300 Effective search space: 104400 Effective search space used: 104400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory