GapMind for catabolism of small carbon sources

 

Protein WP_052666100.1 in Nitriliruptor alkaliphilus DSM 45188

Annotation: NCBI__GCF_000969705.1:WP_052666100.1

Length: 322 amino acids

Source: GCF_000969705.1 in NCBI

Candidate for 22 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-glutamate catabolism gluD med GluD aka CGL1953, component of Glutamate porter (characterized) 39% 83% 171 Arginine transport system permease protein ArtQ 34% 129.8
L-histidine catabolism Ac3H11_2554 lo ABC transporter for L-Histidine, permease component 1 (characterized) 33% 96% 124.8 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-asparagine catabolism aatM lo Glutamate/aspartate import permease protein GltK (characterized) 33% 92% 118.6 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-aspartate catabolism aatM lo Glutamate/aspartate import permease protein GltK (characterized) 33% 92% 118.6 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-glutamate catabolism gltK lo Glutamate/aspartate import permease protein GltK (characterized) 33% 92% 118.6 GluD aka CGL1953, component of Glutamate porter 39% 171.0
D-alanine catabolism Pf6N2E2_5404 lo ABC transporter for D-Alanine, permease component 1 (characterized) 34% 58% 115.2 GluD aka CGL1953, component of Glutamate porter 39% 171.0
D-glucosamine (chitosamine) catabolism AO353_21715 lo ABC transporter for D-Glucosamine Hydrochloride, permease component 2 (characterized) 33% 95% 111.7 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-histidine catabolism aapM lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 2 (characterized) 31% 58% 109.4 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-asparagine catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 31% 56% 108.6 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-aspartate catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 31% 56% 108.6 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-glutamate catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 31% 56% 108.6 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-leucine catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 31% 56% 108.6 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-proline catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 31% 56% 108.6 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-asparagine catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 31% 88% 106.3 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-aspartate catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 31% 88% 106.3 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-asparagine catabolism bztC lo BztC, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 30% 60% 103.6 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-aspartate catabolism bztC lo BztC, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 30% 60% 103.6 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-glutamate catabolism bztC lo BztC, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 30% 60% 103.6 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-asparagine catabolism peb1D lo Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) 34% 91% 98.6 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-aspartate catabolism peb1D lo Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) 34% 91% 98.6 GluD aka CGL1953, component of Glutamate porter 39% 171.0
D-glucosamine (chitosamine) catabolism AO353_21720 lo ABC transporter for D-Glucosamine, permease component 1 (characterized) 30% 97% 94 GluD aka CGL1953, component of Glutamate porter 39% 171.0
L-lysine catabolism hisQ lo Amino acid ABC transporter, membrane protein (characterized, see rationale) 31% 95% 75.9 GluD aka CGL1953, component of Glutamate porter 39% 171.0

Sequence Analysis Tools

View WP_052666100.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSTVLVEELGPRGKRRVRTASIISLVLLAVLIGFILRQLYVGGQFEARLWAQFVDFETGW
PQFLITGLWGTFRAAIGAIVIALVLGLALALGRLSRLTPLRVVCGVVIDVFRGPPVLLMI
FFAYYALPQILPGGLGTTISRNPLIALVIGLAAYNTAVLAEIFRAGILSLDRGQSEAAYT
VGMTHSKAMRLVILPQALRRMIPAIVAQLATLTKDTALGYIITVTDDLMGRGRSFVQGSP
INDLQTWFVVGILYFIIVWMLTRLARRLEVQQRRKLGAGAIAVGGEADLDALAEEVEADE
PELHQGGTGGAVDEAGAGAPRV

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory