Align 3-oxo-acyl CoA thiolase (EC 2.3.1.16) (characterized)
to candidate WP_052666500.1 NITAL_RS12465 acetyl-CoA acetyltransferase
Query= metacyc::G185E-7833-MONOMER (386 letters) >NCBI__GCF_000969705.1:WP_052666500.1 Length = 383 Score = 494 bits (1271), Expect = e-144 Identities = 251/387 (64%), Positives = 300/387 (77%), Gaps = 5/387 (1%) Query: 1 MTEAYVIDAVRTAVGKRGGALAGIHPVDLGALAWRGLLDRTDIDPAAVDDVIAGCVDAIG 60 M EAY+IDAVRT VGKRGG LA +H DLGA R L++RT ID +AVDDV+ G VD +G Sbjct: 1 MPEAYLIDAVRTPVGKRGGGLADVHAADLGAHVLRALVERTGIDASAVDDVVFGAVDTVG 60 Query: 61 GQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGAQAIMSGTADVIVAGGVQNMS 120 AG+IAR WLAAG PEEVPG TVDRQCGSSQQA+ F AQA+MSGT D++VAGGVQ MS Sbjct: 61 PLAGDIARTCWLAAGLPEEVPGTTVDRQCGSSQQAVHFAAQAVMSGTQDLVVAGGVQTMS 120 Query: 121 QIPISSAMTVGEQFGFTSPTNESKQWLHRYGDQEISQFRGSELIAEKWNLSREEMERYSL 180 IPI ++M VG+ FGF P + S+ W RYGDQ +SQF G+E+IA+KW ++RE ME ++ Sbjct: 121 AIPIGASMRVGKHFGFDDPFSGSQGWKERYGDQPVSQFAGAEMIADKWGVTREAMEAFAY 180 Query: 181 TSHERAFAAIRAGHFENEIITVETESGPFRVDEGPR-ESSLEKMAGLQPLVEGGRLTAAM 239 SH+RA AI G F+ EI G DEGPR +++LEKMA L+ L++GGRLTAA+ Sbjct: 181 ESHQRATRAIAEGRFDREI----APYGDVVHDEGPRPDTTLEKMASLKTLIDGGRLTAAL 236 Query: 240 ASQISDGASAVLLASERAVKDHGLRPRARIHHISARAADPVFMLTGPIPATRYALDKTGL 299 +SQISDG++A+L+ASERAV+ HGL PRARIHH+S R A P+ ML PIPAT +AL++TGL Sbjct: 237 SSQISDGSAALLVASERAVEQHGLTPRARIHHLSVRGASPITMLDAPIPATAHALERTGL 296 Query: 300 AIDDIDTVEINEAFAPVVMAWLKEIKADPAKVNPNGGAIALGHPLGATGAKLFTTMLGEL 359 DDID VEINEAFA VV+AW KE D KVN NGGAI+LGHPLGATGA+L TT+L EL Sbjct: 297 TPDDIDLVEINEAFASVVLAWQKETGFDLGKVNVNGGAISLGHPLGATGARLMTTLLHEL 356 Query: 360 ERIGGRYGLQTMCEGGGTANVTIIERL 386 ER GGRYGLQTMCEGGG ANVTIIERL Sbjct: 357 ERTGGRYGLQTMCEGGGQANVTIIERL 383 Lambda K H 0.317 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 517 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 383 Length adjustment: 30 Effective length of query: 356 Effective length of database: 353 Effective search space: 125668 Effective search space used: 125668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory