Align 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) (characterized)
to candidate WP_052669195.1 NITAL_RS00610 4-hydroxyphenylpyruvate dioxygenase
Query= BRENDA::Q53586 (381 letters) >NCBI__GCF_000969705.1:WP_052669195.1 Length = 368 Score = 404 bits (1039), Expect = e-117 Identities = 212/365 (58%), Positives = 254/365 (69%), Gaps = 9/365 (2%) Query: 19 PVKGMDAVVFAVGNAKQAAHYYSTAFGMQLVAYSGPENGSRETASYVLTNGSARFVLTSV 78 P+KG DA+ F VGNAKQAAH+Y TAFG +LV Y+GPE G R+ ASYVL S RFVLT+ Sbjct: 11 PLKGYDAIEFWVGNAKQAAHFYRTAFGFKLVGYAGPETGVRDRASYVLQQRSIRFVLTTG 70 Query: 79 IKPATPWGHFLADHVAEHGDGVVDLAIEVPDARAAHAYAIEHGARSVAEPYELKDEHGTV 138 + H + H A HGDGV D+A VP A A A+E GA EP ++DEHG V Sbjct: 71 LTA----DHEVTRHQAVHGDGVRDVAFRVPAAEEAFRMAVERGATPFTEPEVVEDEHGKV 126 Query: 139 VLAAIATYGKTRHTLVDRTGYDGPYLPGYVA--AAPIVEPPAHRTFQAIDHCVGNVELGR 196 V AAI YG T HT V R Y G YLPGY A A P+ P AIDH V NVE G Sbjct: 127 VRAAIRAYGDTIHTFVQRDDYSGVYLPGYQAVDADPLARPVG---LSAIDHVVCNVEEGE 183 Query: 197 MNEWVGFYNKVMGFTNMKEFVGDDIATEYSALMSKVVADGTLKVKFPINEPALAKKKSQI 256 M+ W FY ++MGF+ ++ F + I+TEY+ALMSKV+ DG ++K PINEPA KKKSQI Sbjct: 184 MDTWARFYERIMGFSQLRHFDDEAISTEYTALMSKVLWDGHGRIKLPINEPAEGKKKSQI 243 Query: 257 DEYLEFYGGAGVQHIALNTGDIVETVRTMRAAGVQFLDTPDSYYDTLGEWVGDTRVPVDT 316 DEYL++YG GVQH+AL+TGDIV TVR +R GV FL PD YY E VG+ D Sbjct: 244 DEYLQYYGSPGVQHLALSTGDIVATVRQLRDNGVSFLTVPDEYYLGAKERVGEVDESWDD 303 Query: 317 LRELKILADRDEDGYLLQIFTKPVQDRPTVFFEIIERHGSMGFGKGNFKALFEAIEREQE 376 L+EL IL DRD++GYLLQIFT+PV+DRPTVF+E+IERHG+MGFG GNFKALFE+IER QE Sbjct: 304 LQELGILVDRDDEGYLLQIFTEPVEDRPTVFYEVIERHGAMGFGVGNFKALFESIERAQE 363 Query: 377 KRGNL 381 +RGNL Sbjct: 364 RRGNL 368 Lambda K H 0.318 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 546 Number of extensions: 33 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 368 Length adjustment: 30 Effective length of query: 351 Effective length of database: 338 Effective search space: 118638 Effective search space used: 118638 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_052669195.1 NITAL_RS00610 (4-hydroxyphenylpyruvate dioxygenase)
to HMM TIGR01263 (hppD: 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01263.hmm # target sequence database: /tmp/gapView.21217.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01263 [M=353] Accession: TIGR01263 Description: 4HPPD: 4-hydroxyphenylpyruvate dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-138 446.8 0.0 4.2e-138 446.6 0.0 1.0 1 lcl|NCBI__GCF_000969705.1:WP_052669195.1 NITAL_RS00610 4-hydroxyphenylpyr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000969705.1:WP_052669195.1 NITAL_RS00610 4-hydroxyphenylpyruvate dioxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 446.6 0.0 4.2e-138 4.2e-138 2 353 .] 14 368 .] 13 368 .] 0.98 Alignments for each domain: == domain 1 score: 446.6 bits; conditional E-value: 4.2e-138 TIGR01263 2 gfdfvefavgdakqaakalveklGfeavak...etgsrekastvlrqgeitlvltaelsssseaaafla 67 g+d +ef+vg+akqaa+ + +++Gf++v++ etg r++as+vl+q +i++vlt+ l+ ++e+++++a lcl|NCBI__GCF_000969705.1:WP_052669195.1 14 GYDAIEFWVGNAKQAAHFYRTAFGFKLVGYagpETGVRDRASYVLQQRSIRFVLTTGLTADHEVTRHQA 82 899****************************************************************** PP TIGR01263 68 kHGdgvkdvafevedveaafeaavergaeavsapee.ed.ekevklaaikgiGdvvltlveregekgsi 134 HGdgv+dvaf+v +e+af+ averga+++++pe ed +++v aai+++Gd+++t+v+r +++g + lcl|NCBI__GCF_000969705.1:WP_052669195.1 83 VHGDGVRDVAFRVPAAEEAFRMAVERGATPFTEPEVvEDeHGKVVRAAIRAYGDTIHTFVQRDDYSGVY 151 **********************************998888***************************** PP TIGR01263 135 lpgfeevsekaalkekledvgleaiDHvvgnvergelekvaefyekilgfkeiksfd...ikteasaLk 200 lpg+++v + l++ vgl aiDHvv nve+ge++++a fye+i+gf+++++fd i+te++aL+ lcl|NCBI__GCF_000969705.1:WP_052669195.1 152 LPGYQAVDAD-PLAR---PVGLSAIDHVVCNVEEGEMDTWARFYERIMGFSQLRHFDdeaISTEYTALM 216 *****87775.5555...59************************************************* PP TIGR01263 201 SkvlasaegkvklplnepaskkkksQIeeyleeyeGaGvQHlAlntedivktveelrargveflkipet 269 Skvl + +g++klp+nepa++kkksQI+eyl++y +GvQHlAl+t div+tv++lr++gv fl++p++ lcl|NCBI__GCF_000969705.1:WP_052669195.1 217 SKVLWDGHGRIKLPINEPAEGKKKSQIDEYLQYYGSPGVQHLALSTGDIVATVRQLRDNGVSFLTVPDE 285 ********************************************************************* PP TIGR01263 270 YYdnlkervkklvkedleelkelkiLvDrdeeGlLLQiFtkpvvdrgtlFfEiIqRkgakGFGegNfka 338 YY kerv++ v+e++++l+el+iLvDrd+eG+LLQiFt+pv dr+t+F+E+I+R+ga+GFG gNfka lcl|NCBI__GCF_000969705.1:WP_052669195.1 286 YYLGAKERVGE-VDESWDDLQELGILVDRDDEGYLLQIFTEPVEDRPTVFYEVIERHGAMGFGVGNFKA 353 **********7.********************************************************* PP TIGR01263 339 LfeaiEreqekrgvl 353 Lfe+iEr qe+rg+l lcl|NCBI__GCF_000969705.1:WP_052669195.1 354 LFESIERAQERRGNL 368 *************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (353 nodes) Target sequences: 1 (368 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.30 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory