Align UTP-glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (characterized)
to candidate WP_057506693.1 ABB28_RS00225 UTP--glucose-1-phosphate uridylyltransferase
Query= BRENDA::Q8PK83 (297 letters) >NCBI__GCF_001431535.1:WP_057506693.1 Length = 294 Score = 485 bits (1248), Expect = e-142 Identities = 238/294 (80%), Positives = 273/294 (92%) Query: 1 MSQRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNR 60 MS+RIRKAVFPVAGLGTRFLPATKTVPKEMLPIID+PLIQYAVDEAI+AGCDTLIF+TNR Sbjct: 1 MSKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDRPLIQYAVDEAIEAGCDTLIFITNR 60 Query: 61 YKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPDGVRAIFVTQAEALGLGHAVLCAK 120 YKH++ADYFDKAYELEQKLERAGKLEQLELVRH LP+GVRA+FVTQAEALGLGHAVLCAK Sbjct: 61 YKHAVADYFDKAYELEQKLERAGKLEQLELVRHVLPNGVRAVFVTQAEALGLGHAVLCAK 120 Query: 121 AVVGNEPFAVLLPDDLMWNRGDAALTQMANVAEASGGSVIAVEDVPHDKTASYGIVSTDA 180 ++G+EPFAVLLPDDL++NRGD+AL QMA++ EA+G SVIAVEDVPH++TASYGIV+T+A Sbjct: 121 EIIGDEPFAVLLPDDLIYNRGDSALKQMADLNEATGASVIAVEDVPHEQTASYGIVATEA 180 Query: 181 FDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFDLLEATGAGAGGEIQLTDAIAEL 240 FDG GRI+AIVEKPKP+ APS+LAVVGRYVLSPKIF+LLEATG GAGGEIQLTDAIAEL Sbjct: 181 FDGSHGRISAIVEKPKPDDAPSDLAVVGRYVLSPKIFELLEATGTGAGGEIQLTDAIAEL 240 Query: 241 LKEEQVDAFRFEGRRFDCGAHIGLIEATVHFALEHEKHGGPAKEILREALAQAD 294 LK E VDA+RF+GRRFDCG H+GL+EAT+ FAL +K PA++ L+E LA+ D Sbjct: 241 LKTEPVDAYRFQGRRFDCGTHLGLVEATIRFALNSKKLAKPARQKLQEMLAEED 294 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 297 Length of database: 294 Length adjustment: 26 Effective length of query: 271 Effective length of database: 268 Effective search space: 72628 Effective search space used: 72628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_057506693.1 ABB28_RS00225 (UTP--glucose-1-phosphate uridylyltransferase)
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01099.hmm # target sequence database: /tmp/gapView.30499.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01099 [M=261] Accession: TIGR01099 Description: galU: UTP--glucose-1-phosphate uridylyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-111 357.5 0.0 2.7e-111 357.3 0.0 1.0 1 lcl|NCBI__GCF_001431535.1:WP_057506693.1 ABB28_RS00225 UTP--glucose-1-pho Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057506693.1 ABB28_RS00225 UTP--glucose-1-phosphate uridylyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 357.3 0.0 2.7e-111 2.7e-111 1 261 [] 5 267 .. 5 267 .. 0.98 Alignments for each domain: == domain 1 score: 357.3 bits; conditional E-value: 2.7e-111 TIGR01099 1 irkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraiedhfDtsy 69 irkav+P+aGlGtr+LPatk++Pkemlpi+d+Pliqy+v+ea+eaG++ ++++t+r k+a+ d+fD++y lcl|NCBI__GCF_001431535.1:WP_057506693.1 5 IRKAVFPVAGLGTRFLPATKTVPKEMLPIIDRPLIQYAVDEAIEAGCDTLIFITNRYKHAVADYFDKAY 73 89******************************************************************* PP TIGR01099 70 eleaklekknkeellkevrkiael.atilyvrqkeakGLGhavllaeelvgdepfavllgDdlvseeee 137 ele+kle+++k e+l+ vr++ ++ ++ ++v q ea GLGhavl+a+e++gdepfavll+Ddl+ ++ + lcl|NCBI__GCF_001431535.1:WP_057506693.1 74 ELEQKLERAGKLEQLELVRHVLPNgVRAVFVTQAEALGLGHAVLCAKEIIGDEPFAVLLPDDLIYNRGD 142 **********************9989************************************9988765 PP TIGR01099 138 .alkqlielyektgasiiaveevpkeevskYGvidgeeveeelyevkdlvekPkpeeapsnlaivGrYv 205 alkq+ +l e tgas+iave+vp+e++ +YG++++e + + +++++vekPkp++aps+la+vGrYv lcl|NCBI__GCF_001431535.1:WP_057506693.1 143 sALKQMADLNEATGASVIAVEDVPHEQTASYGIVATEAFDGSHGRISAIVEKPKPDDAPSDLAVVGRYV 211 5******************************************************************** PP TIGR01099 206 ltpeifelleetkaGkggeiqltDalrlllekeevlavklkgkryDvGdklgylka 261 l+p+ifelle t +G+ggeiqltDa++ ll++e v a++++g+r+D+G++lg ++a lcl|NCBI__GCF_001431535.1:WP_057506693.1 212 LSPKIFELLEATGTGAGGEIQLTDAIAELLKTEPVDAYRFQGRRFDCGTHLGLVEA 267 ****************************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (294 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.49 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory