Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_057506720.1 ABB28_RS00375 UDP-glucose 4-epimerase GalE
Query= curated2:Q9KDV3 (334 letters) >NCBI__GCF_001431535.1:WP_057506720.1 Length = 331 Score = 345 bits (884), Expect = 1e-99 Identities = 173/321 (53%), Positives = 213/321 (66%) Query: 3 ILVTGGAGYIGSHTVLFLLEQGEQVIVLDNLQKGHAGALSDVTFYHGDIRDDQLLDTIFT 62 IL+ GGAGYIGSH +L +QG +V VLDNL GH GA+ F H D+ D LD Sbjct: 4 ILICGGAGYIGSHMSHWLHDQGHRVTVLDNLSTGHRGAVRWGDFIHADLLDPASLDRALA 63 Query: 63 THSIDTVIHFAANSLVGESVKQPIEYYENNVIGTHTLLKKMLEHDVKKIVFSSTAATYGE 122 D V+HF A SLVGESV QP YY NNV GT LL+ M HDV +IVFSSTAA +G Sbjct: 64 GGHFDAVMHFCARSLVGESVTQPYAYYLNNVAGTLNLLEAMRRHDVGRIVFSSTAAVFGN 123 Query: 123 PVQIPIQESDPTIPTNPYGETKLAIEKMFHWCQEAYGLQYVCLRYFNAAGADPNGRIGED 182 PV I E P P NPYG +KL E++ AYGL+ V LRYFNAAGA P+ IGE Sbjct: 124 PVADLIDEEHPKAPINPYGASKLMAERILADAAHAYGLRSVTLRYFNAAGALPDQGIGEA 183 Query: 183 HSPESHLIPIVLQVALGQRERVAIFGDDYQTEDGSCIRDYIHVMDLANAHYLACEHLRKD 242 H E+HLIP VL+ ALG + +FGDDY T DG+C+RDY+HV DLA AH LA + + Sbjct: 184 HLCETHLIPNVLKAALGDGPALKVFGDDYPTPDGTCVRDYVHVQDLAQAHALALDFMEAS 243 Query: 243 GQSGSFNLGNGKGFSVKEVIEVCRQVTGHPIPAEIAPRRSGDPASLIASSEKAQTILGWE 302 + +FNLGNG+GFSV+EVI +V+G P+P E+APRR GDPASL+ASS KA+ LGW Sbjct: 244 AGAHAFNLGNGQGFSVREVIATAAEVSGKPVPFEVAPRRDGDPASLVASSAKARAQLGWV 303 Query: 303 PKYPSLETMVEHAWNWHKEHP 323 P++ L ++E AW WH++ P Sbjct: 304 PRWTELGPIIESAWRWHRDQP 324 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 331 Length adjustment: 28 Effective length of query: 306 Effective length of database: 303 Effective search space: 92718 Effective search space used: 92718 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_057506720.1 ABB28_RS00375 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.13656.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-132 426.2 0.0 4e-132 426.0 0.0 1.0 1 lcl|NCBI__GCF_001431535.1:WP_057506720.1 ABB28_RS00375 UDP-glucose 4-epim Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057506720.1 ABB28_RS00375 UDP-glucose 4-epimerase GalE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 426.0 0.0 4e-132 4e-132 1 329 [. 3 324 .. 3 327 .. 0.99 Alignments for each domain: == domain 1 score: 426.0 bits; conditional E-value: 4e-132 TIGR01179 1 kiLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekitevklvegdladkekleavleee 69 kiL+ GgaGyiGsh+ + l ++g++v vlDnls+g++ a+++++ ++++dl d ++l+++l+ lcl|NCBI__GCF_001431535.1:WP_057506720.1 3 KILICGGAGYIGSHMSHWLHDQGHRVTVLDNLSTGHRGAVRWGD------FIHADLLDPASLDRALAGG 65 79******************************************......******************* PP TIGR01179 70 kidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEesp 138 ++dav+Hf a+ vgEsv++P YY nnv +tl+Lleam+++ v +++Fss+aav+g++ + i Ee+p lcl|NCBI__GCF_001431535.1:WP_057506720.1 66 HFDAVMHFCARSLVGESVTQPYAYYLNNVAGTLNLLEAMRRHDVGRIVFSSTAAVFGNPVADLIDEEHP 134 ********************************************************************* PP TIGR01179 139 lnpinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknathliklvaevavgkr 207 +pinpYG+sklm+Eril d+++a ++l+ v LRYFn+aGA +++ iGea+ +thli+ v+++a+g lcl|NCBI__GCF_001431535.1:WP_057506720.1 135 KAPINPYGASKLMAERILADAAHA-YGLRSVTLRYFNAAGALPDQGIGEAHLCETHLIPNVLKAALGDG 202 ************************.******************************************** PP TIGR01179 208 ekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkvsg 276 ++l++fG+dypt+DGtcvRDy+Hv+Dla+aH al+ +e++++++++nlG+gqgfsv+evi ++ +vsg lcl|NCBI__GCF_001431535.1:WP_057506720.1 203 PALKVFGDDYPTPDGTCVRDYVHVQDLAQAHALALDFMEASAGAHAFNLGNGQGFSVREVIATAAEVSG 271 ********************************************************************* PP TIGR01179 277 kdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekklk 329 k++++e+a+rR+GDpaslva+++k++++lgw p++++L ii+saw+W++ ++ lcl|NCBI__GCF_001431535.1:WP_057506720.1 272 KPVPFEVAPRRDGDPASLVASSAKARAQLGWVPRWTELGPIIESAWRWHRDQP 324 *************************************************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (331 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.14 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory