Align Peroxisomal multifunctional enzyme A; MFE-A; MFE-1; EC 1.1.1.35 (characterized)
to candidate WP_057506922.1 ABB28_RS01450 SDR family oxidoreductase
Query= SwissProt::Q9NKW1 (441 letters) >NCBI__GCF_001431535.1:WP_057506922.1 Length = 299 Score = 119 bits (299), Expect = 1e-31 Identities = 79/263 (30%), Positives = 126/263 (47%), Gaps = 10/263 (3%) Query: 3 LNFKDKVVIVTGAGGGIGKVYALEFAKRGAKVVVNDLGGSHTGQGSSSKAADKVVEEIKA 62 L+F +V ++TGA GG+G Y A+ GAKVV+ D+G G+G + ++ Sbjct: 6 LSFNGQVGLITGAAGGLGLAYTRLLARLGAKVVMQDVGADRDGEGRDPDRVARAAARLRV 65 Query: 63 AGGTAVA---NYDSVEDGEKIVQTAMDSFGGVDILINNAGILRDVSFGKMTDGDWDLVYR 119 G + + D+ +V + G +D +I+NAG + + + + + Sbjct: 66 EGLDVTSRGLSIDTRAQCHALVDEVLGQHGRLDFIIHNAGWVHYQPIEDIGELQLERMLD 125 Query: 120 VHAKGAYKLSRAAWNHMREKNFGRIIMTSSAAGLYGNF---GQANYGSMKMALVGLSNTL 176 + AK L++AAW MR GRI++T+S LY + G A+Y K A VGL N L Sbjct: 126 IAAKAPLWLAQAAWPAMRAAGGGRIVLTTSDRALYPQYVQHGLASYAMAKSAAVGLMNVL 185 Query: 177 AQEGKSKNIHCNTIAPIAASRLTESVMPPEILEQMKPDYIVPLVLYLCHQDTTETGGVFE 236 A EG++ NI N ++P+A +R+ P +++ P + P V +L + G V Sbjct: 186 AAEGEADNIIVNAVSPVAKTRMWGVYGEP---DELHPAAVAPGVAWLASSRCVQGGWVLR 242 Query: 237 VGAGWVSKVRLQRSAGV-YMKDL 258 G R Q AGV Y +DL Sbjct: 243 ASNGQFHATRAQEPAGVSYPRDL 265 Lambda K H 0.313 0.131 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 441 Length of database: 299 Length adjustment: 29 Effective length of query: 412 Effective length of database: 270 Effective search space: 111240 Effective search space used: 111240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory