Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate WP_057507327.1 ABB28_RS03690 ABC transporter ATP-binding protein
Query= TCDB::P73721 (252 letters) >NCBI__GCF_001431535.1:WP_057507327.1 Length = 231 Score = 130 bits (327), Expect = 2e-35 Identities = 79/208 (37%), Positives = 117/208 (56%), Gaps = 8/208 (3%) Query: 7 PLISFDQLQKNFGA----LQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISG 62 P++ Q+ K++ + VLRG+ I + ++I GPSG GK+T + L L+ S Sbjct: 3 PILELQQVHKHYAMAGEQVPVLRGIDLTIDRNEYVAITGPSGSGKTTLMNILGCLDRPSA 62 Query: 63 GRLEVAGVDLSGAKIDQKHLRQLRVR-VGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMA 121 G +AG ++ +D++ + +R R +G VFQ FNL T LQN + P ++ A Sbjct: 63 GSYLLAGQPVTC--LDEREMAGVRNRAIGFVFQSFNLMSRATALQNAM-HPLLYRKMGRA 119 Query: 122 EAKDRALTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPEL 181 E + R + L KVGL +A + P QLSGGQ+QRVAIAR LC P ILL DEPT LD Sbjct: 120 ERQQRGMDALCKVGLADRAGHLPSQLSGGQRQRVAIARALCGSPSILLADEPTGNLDSAT 179 Query: 182 VGEVLNVMKQLAEEGMTMAVVTHEMQFA 209 +++ + L +G T+ ++THE A Sbjct: 180 TRDIMALFDALWADGSTIVMITHETDIA 207 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 231 Length adjustment: 23 Effective length of query: 229 Effective length of database: 208 Effective search space: 47632 Effective search space used: 47632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory