Align ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized)
to candidate WP_057507407.1 ABB28_RS04055 cell division ATP-binding protein FtsE
Query= reanno::pseudo3_N2E3:AO353_16275 (244 letters) >NCBI__GCF_001431535.1:WP_057507407.1 Length = 228 Score = 140 bits (352), Expect = 3e-38 Identities = 77/224 (34%), Positives = 132/224 (58%), Gaps = 3/224 (1%) Query: 1 MISIKNVNKWY-GDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDVV 59 ++ NV+K Y G + LTD S +V GE++ V G SG+GKSTL+K ++ E +G VV Sbjct: 3 VLRFDNVSKQYAGGHEALTDVSFDVAPGEMVFVTGHSGAGKSTLLKLIHLDERPSRGAVV 62 Query: 60 VDGTSIADPKT-DLPKLRSRVGMVFQHFELFPHLTITENLTIAQIKVLGRSKEEATKKGL 118 + ++ + D+P+ R VG V+Q L +I EN+ + I + G + + K+ Sbjct: 63 FNERNLLKVRGGDVPRHRREVGAVYQDHRLLMDRSIAENVALPLI-LRGTRRADIGKRVR 121 Query: 119 QLLERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEVLDV 178 +LER+GL P QLS G+QQRV IARA+ +P +++ DEPT LDP + E++ + Sbjct: 122 SVLERMGLGHREKALPSQLSAGEQQRVGIARAIVGEPRLLVADEPTGNLDPTLAAEIMAL 181 Query: 179 MVQLANEGMTMMCVTHEMGFARKVADRVIFMDQGKIIEDCKKEE 222 +L G +++ V+H++ R++ RV+ +D G++++D ++ Sbjct: 182 FAELPARGTSVLVVSHDLALLRRMRKRVLILDHGRLVDDISPQD 225 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 114 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 228 Length adjustment: 23 Effective length of query: 221 Effective length of database: 205 Effective search space: 45305 Effective search space used: 45305 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory