Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_057507496.1 ABB28_RS04570 SDR family NAD(P)-dependent oxidoreductase
Query= BRENDA::Q1J2J0 (255 letters) >NCBI__GCF_001431535.1:WP_057507496.1 Length = 253 Score = 163 bits (413), Expect = 3e-45 Identities = 107/242 (44%), Positives = 140/242 (57%), Gaps = 10/242 (4%) Query: 17 DGRHALVTGGAQGIGFEIARGLAQAGARVTIADLN-PDV----GEGAA-RELDGTFERLN 70 + + +VTG GIG AR + AGA V +AD + PDV GE AA R L + + Sbjct: 4 NAKTVIVTGAGSGIGAATARAFSNAGANVVLADRDHPDVAALAGELAAERTLVHDVDVSD 63 Query: 71 VTDADAVADLA-RRLPDVDVLVNNAGIVRNAPAEDTPDDDWRAVLSVNLDGVFWCCREFG 129 A+ D +R +DV+ NNAGI+ PAEDT +DW +++VNL GVF CR Sbjct: 64 EAQVQALVDATVKRFGGLDVIFNNAGILVEGPAEDTSLEDWNRIVAVNLTGVFLGCRA-A 122 Query: 130 RTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASRGVRVNAVA 189 L + +G IV+TAS+SGL ++ P AYNA K AV +LTR+LA + GVRVNAV Sbjct: 123 LPELRKRKGCIVNTASVSGLAADRNMP--AYNAVKGAVANLTRALAIDNGRHGVRVNAVC 180 Query: 190 PGYTATPLTRRGLETPEWRETWLKETPLGRLAEPREIAPAVLYLASDAASFVTGHTLVVD 249 P +T T +T + +L P+GRL EP +IA AVL LASD A F+TG L VD Sbjct: 181 PTFTRTSMTAEKEKDKALVTNFLNRIPMGRLGEPEDIANAVLLLASDHAGFITGVNLPVD 240 Query: 250 GG 251 GG Sbjct: 241 GG 242 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 253 Length adjustment: 24 Effective length of query: 231 Effective length of database: 229 Effective search space: 52899 Effective search space used: 52899 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory