Align NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_057507534.1 ABB28_RS04735 ABC transporter ATP-binding protein
Query= TCDB::Q8YT15 (247 letters) >NCBI__GCF_001431535.1:WP_057507534.1 Length = 229 Score = 102 bits (253), Expect = 9e-27 Identities = 60/202 (29%), Positives = 115/202 (56%), Gaps = 5/202 (2%) Query: 23 KDVDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFGLLTPHTGKITFKGKNIAGLKSN 82 + V +L G++ +E+G+ V ++GP+G+GK+TL I GL +P G+IT +G+ I + Sbjct: 19 EQVKVLHGIDLDIETGDFVALMGPSGSGKTTLLNLIGGLDSPSGGEITIEGERIDQMGGG 78 Query: 83 QIVRLG---MCYVPQIANVFPSLSVEENLEMGAFIRN-DSLQPLKDKIFAM-FPRLSDRR 137 Q+ + +V Q N+ P L+ ++N+E+ + + + Q ++ A+ L+DRR Sbjct: 79 QLSTWRSHHVGFVFQFYNLMPMLTAQKNVELPLLLTHLGAAQRRRNAEIALTLVGLADRR 138 Query: 138 RQRAGTLSGGERQMLAMGKALMLEPSLLVLDEPSAALSPILVTQVFEQVKQINQEGTAII 197 R LSGG++Q +A+ +A++ +P+ L+ DEP+ L ++ + ++Q+N+E I Sbjct: 139 SHRPNELSGGQQQRVAIARAIVSDPTFLICDEPTGDLDRQSAEEILQLLQQLNREHGKTI 198 Query: 198 LVEQNARKALEMADRGYVLESG 219 ++ + KA E A L+ G Sbjct: 199 IMVTHDPKAAEYATHTVHLDKG 220 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 229 Length adjustment: 23 Effective length of query: 224 Effective length of database: 206 Effective search space: 46144 Effective search space used: 46144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory