Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_057507534.1 ABB28_RS04735 ABC transporter ATP-binding protein
Query= TCDB::P73650 (240 letters) >NCBI__GCF_001431535.1:WP_057507534.1 Length = 229 Score = 105 bits (261), Expect = 1e-27 Identities = 70/208 (33%), Positives = 112/208 (53%), Gaps = 9/208 (4%) Query: 1 MSDLLVVKDVFAGYVA---DVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTP 57 MS L+ ++ + Y V +L GI+ I G+ V ++GP+G+GK+TL I GL +P Sbjct: 1 MSTLVSLRSITKTYQRGPEQVKVLHGIDLDIETGDFVALMGPSGSGKTTLLNLIGGLDSP 60 Query: 58 SQGEIIFKGENITGLGSDQIV---RRGMCYVPQVCNVFGSLTVAENLDMGAFL-HQGPTQ 113 S GEI +GE I +G Q+ + +V Q N+ LT +N+++ L H G Q Sbjct: 61 SGGEITIEGERIDQMGGGQLSTWRSHHVGFVFQFYNLMPMLTAQKNVELPLLLTHLGAAQ 120 Query: 114 TLKD-RIYTMFPKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILV 172 ++ I LA RR+ R LSGG++Q +A+ RA++ DP L+ DEP+ L Sbjct: 121 RRRNAEIALTLVGLADRRSHRPNELSGGQQQRVAIARAIVSDPTFLICDEPTGDLDRQSA 180 Query: 173 KDVFAQIKAINAT-GKAIILVEQNAKQA 199 +++ ++ +N GK II+V + K A Sbjct: 181 EEILQLLQQLNREHGKTIIMVTHDPKAA 208 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 229 Length adjustment: 23 Effective length of query: 217 Effective length of database: 206 Effective search space: 44702 Effective search space used: 44702 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory