Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_057507562.1 ABB28_RS04910 enoyl-CoA hydratase
Query= BRENDA::Q9I5I4 (272 letters) >NCBI__GCF_001431535.1:WP_057507562.1 Length = 265 Score = 322 bits (826), Expect = 4e-93 Identities = 165/253 (65%), Positives = 188/253 (74%) Query: 19 LTVEKHGHTALITINHPPANTWDRDSLIGLRQLIEHLNRDDDIYALVVTGQGPKFFSAGA 78 L VE GH A+IT+++PPA+TW SL LR L+ LN D IYALV++G+G KFFSAGA Sbjct: 12 LKVEADGHVAVITLHNPPAHTWTVHSLAALRDLVAALNADRSIYALVISGEGEKFFSAGA 71 Query: 79 DLNMFADGDKARAREMARRFGEAFEALRDFRGVSIAAINGYAMGGGLECALACDIRIAER 138 DLN FA GD+ ARE ARRFGEAFEAL FRGVSIAAINGYAMGGGLECALACD+RI E Sbjct: 72 DLNQFASGDRGAAREAARRFGEAFEALSGFRGVSIAAINGYAMGGGLECALACDLRIIEE 131 Query: 139 QAQMALPEAAVGLLPCAGGTQALPWLVGEGWAKRMILCNERVDAETALRIGLVEQVVDSG 198 AQ+ALPEA VGLLPCAGGTQ LP LVGEGWAKRMIL ER+DA+TA+RIGL EQ G Sbjct: 132 HAQVALPEATVGLLPCAGGTQNLPRLVGEGWAKRMILLGERIDADTAVRIGLAEQKAGKG 191 Query: 199 EARGAALLLAAKVARQSPVAIRTIKPLIQGARERAPNTWLPEERERFVDLFDAQDTREGV 258 EA+ AL A K +QSP +I K L+Q R L ERE FVDLFD+ D EGV Sbjct: 192 EAKALALEWAKKAGKQSPTSIAACKTLVQSTRTGTHAAALVAEREAFVDLFDSADQVEGV 251 Query: 259 NAFLEKRDPKWRN 271 +AFLEKR +W+N Sbjct: 252 SAFLEKRSAQWKN 264 Lambda K H 0.321 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 265 Length adjustment: 25 Effective length of query: 247 Effective length of database: 240 Effective search space: 59280 Effective search space used: 59280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory