Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate WP_057507594.1 ABB28_RS05080 isovaleryl-CoA dehydrogenase
Query= metacyc::G1G01-166-MONOMER (393 letters) >NCBI__GCF_001431535.1:WP_057507594.1 Length = 387 Score = 213 bits (543), Expect = 6e-60 Identities = 132/375 (35%), Positives = 198/375 (52%), Gaps = 5/375 (1%) Query: 15 LDQQLTEEERMVRDSAYQFAQDKLAPRVLEAFRHEQTDPAIFREMGEVGLLGATIPEQYG 74 L+ L E+ ++RDS QFA ++AP A Q A++R++GE GLLG T+ E+YG Sbjct: 6 LNFDLGEDIDLLRDSVAQFAAAEIAPLAAHADETNQFPLALWRKLGEQGLLGMTVEEEYG 65 Query: 75 GSGLNYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGTEAQKQKYLPKLASGEWI 134 G+G+ Y+ + + EV R G S+L + + + GT+AQKQ++LP L SGE + Sbjct: 66 GTGMGYLAHVVAMEEVSRASGGIGLSYGAHSNLCVNQLRKNGTQAQKQRFLPGLCSGELV 125 Query: 135 GCFGLTEPNHGSDPGSMITRARKVDGGYRLTGSKMWITNSPIADVFVVWAKDD----AGD 190 G ++EP GSD SM RA K Y L G+KMWITN P ADV VV+AK D A Sbjct: 126 GALAMSEPGAGSDVVSMKLRAEKRGDRYVLNGNKMWITNGPDADVLVVYAKTDPDAGAKG 185 Query: 191 IRGFVLEKGWQGLSAPAIHGKVGLRASITGEIVMDNVFVPEENIF-PDVRGLKGPFTCLN 249 I F++EKG +G S K+G+R+S T E+V + VP EN+ + G++ + L+ Sbjct: 186 ITAFLVEKGMKGFSTAQKLDKLGMRSSPTSELVFQDCEVPAENVLGQEGSGVRVLMSGLD 245 Query: 250 SARYGISWGALGAAEACWHTARQYTLDRQQFGRPLAANQLIQKKLADMQTEITLALQGCL 309 R +S G LG A Y +R QFG + + QLIQ K+ADM + Sbjct: 246 YERVVLSGGPLGLMAAAMDVVMPYVHERHQFGEAIGSFQLIQAKIADMYVGLGACRAYVY 305 Query: 310 RLGRMKDEGTAAVEITSIMKRNSCGKALDIARMARDMLGGNGISDEFGVARHLVNLEVVN 369 + R D+G + + + KA + A +LGGNG +E+ R + ++ Sbjct: 306 AVARACDQGRTTRQDAAGAILYAAEKATWLTGQAIQILGGNGYINEYPTGRLWRDAKLYE 365 Query: 370 TYEGTHDVHALILGR 384 GT ++ +++GR Sbjct: 366 IGAGTSEIRRMLIGR 380 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 360 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 387 Length adjustment: 31 Effective length of query: 362 Effective length of database: 356 Effective search space: 128872 Effective search space used: 128872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory