Align pimeloyl-CoA dehydrogenase large subunit (EC 1.3.1.62) (characterized)
to candidate WP_057507594.1 ABB28_RS05080 isovaleryl-CoA dehydrogenase
Query= metacyc::MONOMER-20676 (396 letters) >NCBI__GCF_001431535.1:WP_057507594.1 Length = 387 Score = 112 bits (279), Expect = 2e-29 Identities = 79/254 (31%), Positives = 123/254 (48%), Gaps = 21/254 (8%) Query: 13 RDEVRQFFKDNVPAKTRQKLIEGRHNTKEEMVEWYRILNKKGWAVTHWPKEYGGTGWSSV 72 RD V QF + L T + + +R L ++G +EYGGTG + Sbjct: 18 RDSVAQFAAAEIAP-----LAAHADETNQFPLALWRKLGEQGLLGMTVEEEYGGTGMGYL 72 Query: 73 QHYIFNEELQAAPAPQPLAFGV--SMVGPVIYTFGSEEQKKRFLPRIANVDDWWCQGFSE 130 H + EE+ A L++G ++ + G++ QK+RFLP + + + SE Sbjct: 73 AHVVAMEEVSRASGGIGLSYGAHSNLCVNQLRKNGTQAQKQRFLPGLCSGELVGALAMSE 132 Query: 131 PGSGSDLASLKTKAEKKGDKWIINGQKTWTTLAQHADWIFCLCRTDPAAKKQEGISFILV 190 PG+GSD+ S+K +AEK+GD++++NG K W T AD + +TDP A +GI+ LV Sbjct: 133 PGAGSDVVSMKLRAEKRGDRYVLNGNKMWITNGPDADVLVVYAKTDPDA-GAKGITAFLV 191 Query: 191 DMKTKGITVRPIQTID----GGHEVNEVFFDDVEVPLENLVGQEN-------KGWDYAKF 239 + KG + Q +D +E+ F D EVP EN++GQE G DY + Sbjct: 192 EKGMKGFST--AQKLDKLGMRSSPTSELVFQDCEVPAENVLGQEGSGVRVLMSGLDYERV 249 Query: 240 LLGNERTGIARVGM 253 +L G+ M Sbjct: 250 VLSGGPLGLMAAAM 263 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 387 Length adjustment: 31 Effective length of query: 365 Effective length of database: 356 Effective search space: 129940 Effective search space used: 129940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory