Align glycolaldehyde oxidoreductase small subunit (characterized)
to candidate WP_057507659.1 ABB28_RS05435 aldehyde dehydrogenase iron-sulfur subunit
Query= metacyc::MONOMER-18073 (163 letters) >NCBI__GCF_001431535.1:WP_057507659.1 Length = 214 Score = 140 bits (352), Expect = 2e-38 Identities = 71/161 (44%), Positives = 95/161 (59%), Gaps = 15/161 (9%) Query: 11 KIKVKVNGVLYERYVSPRILLVDFLREELGLTGTKIGCDTTTCGACTVLLNGKSVKSCTL 70 ++ KVNG + R+ L+D LRE L LTGTK GCD CGACTV+++G+ + +C Sbjct: 48 EVAFKVNGKARALKLDTRVTLLDALREHLHLTGTKKGCDHGQCGACTVIVDGRRINACLS 107 Query: 71 FAVQADGAEITTIEGLSVDSKLHPIQEAFKENFALQCGFCTPGMIMQAYFLLKE------ 124 AV +GAEITTIEGL LHP+Q AF ++ QCG+CTPG I A +LKE Sbjct: 108 LAVMHEGAEITTIEGLGSPDDLHPMQAAFVKHDGYQCGYCTPGQICSAVAVLKEIKDGIP 167 Query: 125 ---------NPNPSEEEVRDGLHGNICRCTGYQNIVKAVLD 156 S EE+R+ + GN+CRC Y NI++A+ D Sbjct: 168 SHVTADLGARSEASAEEIRERMSGNLCRCGAYSNIIEAIED 208 Lambda K H 0.322 0.138 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 214 Length adjustment: 20 Effective length of query: 143 Effective length of database: 194 Effective search space: 27742 Effective search space used: 27742 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory