Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate WP_057507676.1 ABB28_RS05540 ABC transporter ATP-binding protein
Query= TCDB::Q8DT25 (377 letters) >NCBI__GCF_001431535.1:WP_057507676.1 Length = 228 Score = 112 bits (280), Expect = 1e-29 Identities = 62/197 (31%), Positives = 109/197 (55%), Gaps = 11/197 (5%) Query: 22 ENFNLDIH---DKEFIVFVGPSGCGKSTTLRMIAGLEDITEGNLYIDDKLMNDASP---- 74 ++F L + + +V GPSG GKS TL+ IAGL G + +D +++ DA+ Sbjct: 16 QHFRLQVQLHCSQRHVVLFGPSGAGKSLTLKAIAGLLTPDAGRIVLDGQVLFDAAAGICL 75 Query: 75 --KDRDIAMVFQNYALYPHMSVYENMAFGLKLRKY--KKDDINKRVHEAAEILGLTEFLE 130 + R + VFQ+YAL+PH++V +N+AFGL+ + ++ + V + L + + Sbjct: 76 PARARRLGYVFQDYALFPHLTVRQNVAFGLQTGWWNPRRGGRHAEVEHWLQALRIERLGD 135 Query: 131 RKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAKIHRRIGATTI 190 P+ +SGGQRQR A+ RA+V + L+DEP + LD LR +R+E+ + + G + Sbjct: 136 LMPSQVSGGQRQRTALARALVTRPRALLLDEPFAALDHDLRAHLRSELQAVLEQAGIPLL 195 Query: 191 YVTHDQTEAMTLADRIV 207 ++HD + +++ Sbjct: 196 LISHDPQDVTMFGQQVL 212 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 228 Length adjustment: 26 Effective length of query: 351 Effective length of database: 202 Effective search space: 70902 Effective search space used: 70902 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory