Align Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate WP_057507676.1 ABB28_RS05540 ABC transporter ATP-binding protein
Query= SwissProt::Q9YGA6 (372 letters) >NCBI__GCF_001431535.1:WP_057507676.1 Length = 228 Score = 133 bits (334), Expect = 5e-36 Identities = 72/193 (37%), Positives = 110/193 (56%), Gaps = 2/193 (1%) Query: 32 MILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADPEKGIFVPPKDRDIAMVFQSYA 91 ++L GPSG GK+ TL+ IAGL P G+I + +++ D GI +P + R + VFQ YA Sbjct: 31 VVLFGPSGAGKSLTLKAIAGLLTPDAGRIVLDGQVLFDAAAGICLPARARRLGYVFQDYA 90 Query: 92 LYPHMTVYDNIAFPLKLR--KVPRQEIDQRVREVAELLGLTELLNRKPRELSGGQRQRVA 149 L+PH+TV N+AF L+ R V + L + L + P ++SGGQRQR A Sbjct: 91 LFPHLTVRQNVAFGLQTGWWNPRRGGRHAEVEHWLQALRIERLGDLMPSQVSGGQRQRTA 150 Query: 150 LGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYVTHDQVEAMTMGDR 209 L RA+V +P+ L+DEP + LD LR +R+EL+ + Q G+ + ++HD + G + Sbjct: 151 LARALVTRPRALLLDEPFAALDHDLRAHLRSELQAVLEQAGIPLLLISHDPQDVTMFGQQ 210 Query: 210 IAVMNRGVLQQVG 222 + + G Q G Sbjct: 211 VLRLADGRTLQPG 223 Lambda K H 0.323 0.142 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 228 Length adjustment: 26 Effective length of query: 346 Effective length of database: 202 Effective search space: 69892 Effective search space used: 69892 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory