Align ABC transporter for D-mannitol and D-mannose, ATPase component (characterized)
to candidate WP_057507676.1 ABB28_RS05540 ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_25895 (367 letters) >NCBI__GCF_001431535.1:WP_057507676.1 Length = 228 Score = 125 bits (315), Expect = 8e-34 Identities = 82/207 (39%), Positives = 117/207 (56%), Gaps = 17/207 (8%) Query: 22 IDLEVNDREFVVFVGPSGCGKSTLLRLIAGLEEVTAGTIELDGRDITEVS-----PAK-R 75 + L + R V+F GPSG GKS L+ IAGL AG I LDG+ + + + PA+ R Sbjct: 22 VQLHCSQRHVVLF-GPSGAGKSLTLKAIAGLLTPDAGRIVLDGQVLFDAAAGICLPARAR 80 Query: 76 DLAMVFQTYALYPHMSVRKNMSFALDLA------GVNKAEVEKKVNEAARILELGPMLER 129 L VFQ YAL+PH++VR+N++F L G AEVE + +A RI LG ++ Sbjct: 81 RLGYVFQDYALFPHLTVRQNVAFGLQTGWWNPRRGGRHAEVEHWL-QALRIERLGDLM-- 137 Query: 130 KPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELARLHKELQATMIY 189 P Q+SGGQRQR A+ RA+V P+ L DEP + LD LR +R EL + ++ ++ Sbjct: 138 -PSQVSGGQRQRTALARALVTRPRALLLDEPFAALDHDLRAHLRSELQAVLEQAGIPLLL 196 Query: 190 VTHDQVEAMTLADKVVVLNGGRIEQVG 216 ++HD + +V+ L GR Q G Sbjct: 197 ISHDPQDVTMFGQQVLRLADGRTLQPG 223 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 228 Length adjustment: 26 Effective length of query: 341 Effective length of database: 202 Effective search space: 68882 Effective search space used: 68882 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory