Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_057507764.1 ABB28_RS05960 polyamine ABC transporter ATP-binding protein
Query= uniprot:P0DTT6 (251 letters) >NCBI__GCF_001431535.1:WP_057507764.1 Length = 378 Score = 115 bits (288), Expect = 1e-30 Identities = 77/245 (31%), Positives = 130/245 (53%), Gaps = 13/245 (5%) Query: 5 LEIRDVHKSFGAVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRGDLVFE 64 L IRD+ K F A+D V++++ KGE+ ALLG +G+GKSTL++ + G+ P RG +V + Sbjct: 21 LSIRDLRKEFDGFVAVDDVNLDVRKGEIFALLGGSGSGKSTLLRCLGGFETPTRGSIVLD 80 Query: 65 GKKVIFNSPNDARSLGIETIYQDLALIPDLPIYYNIFLAREVTNKIFLNKKKMMEESKKL 124 G+ ++ P + ++Q AL P + + NI + ++ + E +L Sbjct: 81 GQPLVALPP---YKRPVNMMFQSYALFPHMSVEQNIAFGLKQDGLAGDAIRRRVGEMLEL 137 Query: 125 --LDSLQIRIPDINMKVENLSGGQRQAVAVARAVYFSAKMILMDEPTAAL-SVVEARKVL 181 + SL R P LSGGQ+Q VA+AR++ K++L+DEP AL + ++ L Sbjct: 138 VHMTSLAKRRP------HQLSGGQQQRVALARSLAKGPKLLLLDEPMGALDKKLRSQMQL 191 Query: 182 ELARNLKKKGLGVLIITHNIIQGYEVADRIYVLDRGKIIFHKKKEETNVEEITEVMTSFA 241 EL ++ G+ +++TH+ + +A RI V+D G I K +E + + F Sbjct: 192 ELVNIIETSGVTCVMVTHDQEEAMTMATRIAVMDAGWIQQVGKPDEVYEQPANRFVAGF- 250 Query: 242 LGKVN 246 +G VN Sbjct: 251 IGSVN 255 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 378 Length adjustment: 27 Effective length of query: 224 Effective length of database: 351 Effective search space: 78624 Effective search space used: 78624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory