Align Kynurenine 3-monooxygenase; PfKMO; Kynurenine 3-hydroxylase; EC 1.14.13.9 (characterized)
to candidate WP_057507932.1 ABB28_RS06865 FAD-dependent monooxygenase
Query= SwissProt::Q84HF5 (461 letters) >NCBI__GCF_001431535.1:WP_057507932.1 Length = 471 Score = 437 bits (1125), Expect = e-127 Identities = 237/454 (52%), Positives = 298/454 (65%), Gaps = 10/454 (2%) Query: 8 RQVTIIGAGLAGTLVARLLARNGWQVNLFERRPDPRIETGARGRSINLALAERGAHALRL 67 R +TI+GAGLAG+L+A LL+R GW + ++ERR DPR+ GRSINLALAERG +ALR Sbjct: 20 RSLTIVGAGLAGSLLAILLSRQGWNITVYERRGDPRVSGYESGRSINLALAERGRNALRQ 79 Query: 68 AG--LEREVLAEAVMMRGRMVHV-PGTPPNLQPYGRDDSEVIWSINRDRLNRILLDGAEA 124 AG +E V+ AVMMRGRMVH+ G P LQ YGRDDSEVIWSI+R LN LL AE Sbjct: 80 AGAHVEAAVMERAVMMRGRMVHLRDGAAPALQRYGRDDSEVIWSIHRRELNVTLLQLAEQ 139 Query: 125 AGASIHFNLGLDSVDFARQRLT-LSNVSGERLEKRFHLLIGADGCNSAVRQAMASVVDLG 183 AGA +HF+ L +VDF Q + + + RF L+GADG SA+R AM LG Sbjct: 140 AGAVVHFHRRLHTVDFDAQHARFIDDRDDTPHDIRFASLVGADGAGSALRAAMNRRQPLG 199 Query: 184 EHLETQPHGYKELQITPEASAQFNLEPNALHIWPHGDYMCIALPNLDRSFTVTLFLHHQS 243 E +E H YKEL+I P A F+++PNALHIWP G +MCIALPN + +FTVTLFL ++ Sbjct: 200 ERIEFLDHSYKELEIPPGAGGAFSIDPNALHIWPRGRFMCIALPNHEGTFTVTLFLPNKG 259 Query: 244 PAAQPASPCFAQLVDGHAARRFFQRQFPDLSPMLDSLEQDFEHHPTGKLATLRLTTWHVG 303 P F + G A F R+FPD P++ L D++ HP G L TL L WH Sbjct: 260 ------DPGFNTVTTGEQAEALFAREFPDALPLIPDLRADWDAHPPGLLGTLYLERWHTD 313 Query: 304 GQAVLLGDAAHPMVPFHGQGMNCALEDAVALAEHLQSAADNASALAAFTAQRQPDALAIQ 363 G+AVL+GDAAH MVPFHGQGMNCA ED VALA HL +A+D A +AF +R P+A AIQ Sbjct: 314 GKAVLIGDAAHAMVPFHGQGMNCAFEDCVALARHLDAASDLRGAYSAFEIERAPNAWAIQ 373 Query: 364 AMALENYVEMSSKVASPTYLLERELGQIMAQRQPTRFIPRYSMVTFSRLPYAQAMARGQI 423 MALENY EM +VA P +LL+REL + QR PTRF+P Y+MVTF PYA A+ R +I Sbjct: 374 QMALENYTEMRDQVADPAFLLQRELELALQQRWPTRFVPHYTMVTFLHTPYAVALERTRI 433 Query: 424 QEQLLKFAVANHSDLTSINLDAVEHEVTRCLPPL 457 Q ++L+ A L ++ +A++ EV LP L Sbjct: 434 QRRILRNATQGLDSLQQVDWNALQAEVHAKLPML 467 Lambda K H 0.321 0.134 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 662 Number of extensions: 33 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 461 Length of database: 471 Length adjustment: 33 Effective length of query: 428 Effective length of database: 438 Effective search space: 187464 Effective search space used: 187464 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory