Align butyryl-CoA dehydrogenase; EC 1.3.99.2 (characterized)
to candidate WP_057507944.1 ABB28_RS06925 acyl-CoA dehydrogenase
Query= CharProtDB::CH_091785 (379 letters) >NCBI__GCF_001431535.1:WP_057507944.1 Length = 382 Score = 340 bits (871), Expect = 5e-98 Identities = 178/375 (47%), Positives = 251/375 (66%), Gaps = 1/375 (0%) Query: 1 MDFNLTREQELVRQMVREFAENEVKPIAAEIDETERFPMENVKKMGQYGMMGIPFSKEYG 60 MDF+ T EQ +++ + R A+ ++ P A D T FP+ N++ +G+ G+MGI EYG Sbjct: 1 MDFSFTEEQLMLQDVARRIAQEKIAPSAEHHDRTGEFPLANIQLLGENGLMGIEVPAEYG 60 Query: 61 GAGGDVLSYIIAVEELSKVCGTTGVILSAHTSLCASLINEHGTEEQKQKYLVPLAKGEKI 120 GAG D ++Y++A+ E++ I+S + SL + I HG E QKQKY+ +A+G I Sbjct: 61 GAGMDPIAYVLAMVEVAAGDAAHSTIMSVNNSLFCNGILTHGNEAQKQKYVRAIAEGTAI 120 Query: 121 GAYGLTEPNAGTDSGAQQTVAVLEGD-HYVINGSKIFITNGGVADTFVIFAMTDRTKGTK 179 GA+ LTEP +G+D+ A + AV + D YVING K +IT+G VA V+FAMTD KG + Sbjct: 121 GAFALTEPQSGSDATAMRCRAVKQADGSYVINGKKSWITSGPVAKYIVLFAMTDADKGAR 180 Query: 180 GISAFIIEKGFKGFSIGKVEQKLGIRASSTTELVFEDMIVPVENMIGKEGKGFPIAMKTL 239 GISAF+I+ GF GK E KLGIRAS+T E+ F D + E+++G+EG+GF IAM L Sbjct: 181 GISAFLIDTDNAGFGRGKTEPKLGIRASATCEIEFNDYVAQAEDLLGQEGEGFKIAMGVL 240 Query: 240 DGGRIGIAAQALGIAEGAFNEARAYMKERKQFGRSLDKFQGLAWMMADMDVAIESARYLV 299 D GRIGIA+QA+GIA A+ Y+KERK FG ++ FQ +ADM +++A L Sbjct: 241 DAGRIGIASQAIGIARAAYEATLEYVKERKAFGAAIGTFQMTQAKIADMKCKLDAALLLT 300 Query: 300 YKAAYLKQAGLPYTVDAARAKLHAANVAMDVTTKAVQLFGGYGYTKDYPVERMMRDAKIT 359 +AA++K G ++ +AA AKL A+ AM +T +AVQ+ GG GY+K+ P+ER RDAKIT Sbjct: 301 LRAAWVKGEGKRFSNEAAIAKLTASEAAMWITHQAVQIHGGMGYSKEMPLERYFRDAKIT 360 Query: 360 EIYEGTSEVQKLVIS 374 EIYEGTSE+Q+LVI+ Sbjct: 361 EIYEGTSEIQRLVIA 375 Lambda K H 0.317 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 379 Length of database: 382 Length adjustment: 30 Effective length of query: 349 Effective length of database: 352 Effective search space: 122848 Effective search space used: 122848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory