Align D/L-lactic acid transporter; Lactate racemization operon protein LarD; Lactic acid channel (characterized)
to candidate WP_057508100.1 ABB28_RS07840 aquaporin family protein
Query= SwissProt::F9UST3 (238 letters) >NCBI__GCF_001431535.1:WP_057508100.1 Length = 277 Score = 87.4 bits (215), Expect = 3e-22 Identities = 79/259 (30%), Positives = 118/259 (45%), Gaps = 35/259 (13%) Query: 4 QLIAEFMGTALMIIFGVGVHCSSVLKGTKYRGSGHIFAI----TTWGFGISVALFIFGNV 59 QL E + A+ + + + CS+ Y S + A TWG ++VA++ +V Sbjct: 5 QLAGELISEAVAVAIIISIGCSAAAMYLLYDPSPYQNAYWGLCITWGLAVTVAIYATASV 64 Query: 60 C---INPAMVLAQCLLGNIAWSLFIPYSVAEVLGGVVGSVIVWIMYA---DHFKASTDEI 113 NPA+ LA L WS IPY A+VLGG VG+ IV ++Y DH+ +++ Sbjct: 65 SGTHANPAVTLALALYRGFPWSRVIPYWAAQVLGGFVGAAIVLLLYGPVIDHY----NDL 120 Query: 114 SPITI-----RNLFCTAPAVRNLPRNFF-VELFDTFIFISGILAISE---IKTPGI--VP 162 +T +F TAP + P + ++ T + GI AI+E PG Sbjct: 121 QGMTRAEGGGAGVFFTAPGLAVTPLHALRNQVILTGFLVFGIFAITERYNEAAPGANGGA 180 Query: 163 IGVGLLVWAIGMGLGGPTGFAMNLARDMGPRI-------AHAILPIANKADSDWQYGIIV 215 + +GLLV IG +G G+A+N ARD GPR+ A LP + W I+ Sbjct: 181 LMIGLLVACIGASMGYLEGWAINPARDFGPRVFAWLTGWDRAALPAEHHY---WWIPIVG 237 Query: 216 PGIAPFVGAAIAAWFMHGF 234 P I +G A W + F Sbjct: 238 PLIGGALGGAAYRWLILPF 256 Lambda K H 0.330 0.145 0.470 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 277 Length adjustment: 24 Effective length of query: 214 Effective length of database: 253 Effective search space: 54142 Effective search space used: 54142 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory