Align aquaglyceroporin (characterized)
to candidate WP_057508100.1 ABB28_RS07840 MIP/aquaporin family protein
Query= CharProtDB::CH_024677 (281 letters) >NCBI__GCF_001431535.1:WP_057508100.1 Length = 277 Score = 168 bits (426), Expect = 1e-46 Identities = 102/258 (39%), Positives = 141/258 (54%), Gaps = 9/258 (3%) Query: 7 LKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQ---WEISVIWGLGVAMAIYLTAGVS 63 L G+ I+E + ++I G A + S Q W + + WGL V +AIY TA VS Sbjct: 6 LAGELISEAVAVAIIISIGCSAAAMYLLYDPSPYQNAYWGLCITWGLAVTVAIYATASVS 65 Query: 64 GAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHIVR 123 G H NPAVT+AL L+ F +VIP+ +QV G F AA+V LY + + + R Sbjct: 66 GTHANPAVTLALALYRGFPWSRVIPYWAAQVLGGFVGAAIVLLLYGPVIDHYNDLQGMTR 125 Query: 124 GSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGN-GVPRGPLAPLL 182 AG F T P + + A ++++T L+ I A+T+ N P L+ Sbjct: 126 AEGGG---AGVFFTAPGLAVTPLHALRNQVILTGFLVFGIFAITERYNEAAPGANGGALM 182 Query: 183 IGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGPIV 242 IGLL+A IGASMG L G+A+NPARDFGP+VFAWL GW A + Y+ +P+ GP++ Sbjct: 183 IGLLVACIGASMGYLEGWAINPARDFGPRVFAWLTGWDRAALPA--EHHYWWIPIVGPLI 240 Query: 243 GAIVGAFAYRKLIGRHLP 260 G +G AYR LI LP Sbjct: 241 GGALGGAAYRWLILPFLP 258 Lambda K H 0.327 0.143 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 277 Length adjustment: 26 Effective length of query: 255 Effective length of database: 251 Effective search space: 64005 Effective search space used: 64005 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory