Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_057508140.1 ABB28_RS08055 lipoprotein-releasing system ATP-binding protein LolD
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_001431535.1:WP_057508140.1 Length = 237 Score = 97.4 bits (241), Expect = 2e-25 Identities = 75/241 (31%), Positives = 112/241 (46%), Gaps = 28/241 (11%) Query: 13 SPESSLLLAQGLSKSFGGLR----AVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFI 68 SP ++ AQ L K++ R D D+ V G +IG +GAGK+TL +LL Sbjct: 6 SPGQEVIRAQALGKTYAEGRMHTPVFDGLDLQVSAGETVAIIGASGAGKSTLLHLLGGLD 65 Query: 69 RPDQGEVLFNGDSIGQLAPHQIALRGSVRT------FQVAKVLSRLTVLENMLLADQHQT 122 P GEV G + L+ RG +R +Q +L T LEN+++ Sbjct: 66 TPSAGEVFVTGQQMSTLSD---GARGLLRNRALGFVYQFHHLLPEFTALENVMM------ 116 Query: 123 GEKFLPRLINFRRVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALM 182 P L+ V A ++A +LESVGLG + Q G LSGG+R+ +ARAL+ Sbjct: 117 -----PVLLGGGEVA----AANDRARQLLESVGLGHRLQHKPGELSGGERQRAAVARALV 167 Query: 183 SNPKLILLDEPAAGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEG 242 + P +L DEP ++ G + E ++ NR T LV+ + + V L EG Sbjct: 168 NQPACVLGDEPTGNLDDRTAGTVFELMLELNRARHTSLVLVTHDRSLARKLDRVLELREG 227 Query: 243 R 243 + Sbjct: 228 K 228 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 237 Length adjustment: 24 Effective length of query: 243 Effective length of database: 213 Effective search space: 51759 Effective search space used: 51759 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory