Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_057508148.1 ABB28_RS08100 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= uniprot:D4GP39 (383 letters) >NCBI__GCF_001431535.1:WP_057508148.1 Length = 362 Score = 317 bits (813), Expect = 3e-91 Identities = 176/370 (47%), Positives = 242/370 (65%), Gaps = 14/370 (3%) Query: 1 MARLTLDDVTKVYTDEGGGDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETV 60 MA++ L V KVY D G VAV++ + ++ DGE +VLVGPSGCGKST LRM+AGLE + Sbjct: 1 MAKVQLQGVRKVY-DNGQ---VAVKDATFEVADGELMVLVGPSGCGKSTLLRMIAGLEEI 56 Query: 61 TEGELRLEDRVLNGVSAQDRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIRQRV 120 + G L + +RV+N V+ +DRDIAMVFQSYALYPH +V N++FGL+ G I +R+ Sbjct: 57 SGGTLTIGERVVNDVAPKDRDIAMVFQSYALYPHMTVAENLAFGLK-LRGHDKATIDKRI 115 Query: 121 EETTDMLGISDLLDRKPGQLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRT 180 E LG++D++D+ P +SGGQ+QRVALGRA+VR+P VFL+DEPLSNLDAKLR +RT Sbjct: 116 SEAAQTLGLTDMMDKLPKAMSGGQRQRVALGRALVREPAVFLLDEPLSNLDAKLRHSVRT 175 Query: 181 ELQRLQGELGVTTVYVTHDQTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNNLFVAGFI 240 E+ +L +LG T +YVTHDQ EAMT+G R+ VL DG +QQ+ TP++ Y RP NLFVAGF+ Sbjct: 176 EIAQLHRKLGTTMIYVTHDQVEAMTLGQRIVVLKDGVIQQIDTPMELYDRPANLFVAGFL 235 Query: 241 GEPSMNLFDGSL----SGDTFRGDGFDYPLSGATRDQLGGASGLTLGIRPEDVTVGERRS 296 G P+MN+ G+L SG + PL AT D + +G+RPE + + Sbjct: 236 GSPAMNVLRGTLQASASGVVVSDGDWKAPLGHATIDPRWLDKPIAVGVRPEHLQPAD-AG 294 Query: 297 GQRTFDAEVVVVEPQGNENAVHLRFVDGDEGTQFTATTTGQSRVEAGDRTTVSFPEDAIH 356 + TF+A + +EP GNE V+L V G T ++ G+ ++ +A+H Sbjct: 295 AEWTFEARIEGIEPVGNEIFVNL--VSGQHA--LTMRVAPRALPAVGETLKLAVQPNALH 350 Query: 357 LFDGETGDAL 366 FD ETG+ L Sbjct: 351 FFDAETGERL 360 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 362 Length adjustment: 30 Effective length of query: 353 Effective length of database: 332 Effective search space: 117196 Effective search space used: 117196 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory