Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_057508148.1 ABB28_RS08100 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >NCBI__GCF_001431535.1:WP_057508148.1 Length = 362 Score = 157 bits (397), Expect = 3e-43 Identities = 89/228 (39%), Positives = 131/228 (57%), Gaps = 14/228 (6%) Query: 46 VGVNDLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGE----DILQLDM 101 V V D + + GE+ V++G SG GKSTL+R L + SG L GE D+ D Sbjct: 18 VAVKDATFEVADGELMVLVGPSGCGKSTLLRMIAGL-EEISGGTLTIGERVVNDVAPKDR 76 Query: 102 DALREFRRHKISMVFQSFGLLPHKSVLDNVAYGLKVRGESKQVCAERALHWINTVGLKGY 161 D I+MVFQS+ L PH +V +N+A+GLK+RG K +R T+GL Sbjct: 77 D---------IAMVFQSYALYPHMTVAENLAFGLKLRGHDKATIDKRISEAAQTLGLTDM 127 Query: 162 ENKYPHQLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKT 221 +K P +SGG RQRV L RAL + + L+DE S LD +R ++ ++ +L + L T Sbjct: 128 MDKLPKAMSGGQRQRVALGRALVREPAVFLLDEPLSNLDAKLRHSVRTEIAQLHRKLGTT 187 Query: 222 IVFITHDLDEAVRIGNRIAILKDGKLIQVGTPREILHSPADEYVDRFV 269 ++++THD EA+ +G RI +LKDG + Q+ TP E+ PA+ +V F+ Sbjct: 188 MIYVTHDQVEAMTLGQRIVVLKDGVIQQIDTPMELYDRPANLFVAGFL 235 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 362 Length adjustment: 27 Effective length of query: 249 Effective length of database: 335 Effective search space: 83415 Effective search space used: 83415 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory