Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_057508148.1 ABB28_RS08100 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_001431535.1:WP_057508148.1 Length = 362 Score = 101 bits (251), Expect = 2e-26 Identities = 69/227 (30%), Positives = 116/227 (51%), Gaps = 7/227 (3%) Query: 10 LQVKGLKVAY-GGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMNDGNIEY 68 +Q++G++ Y G AVK FEV +GEL+ L+G +G GK+T ++ I G ++ G + Sbjct: 4 VQLQGVRKVYDNGQVAVKDATFEVADGELMVLVGPSGCGKSTLLRMIAGLEEISGGTLTI 63 Query: 69 LGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIR-KDKAGILADIEKMFT 127 + + D + MV + ++ MT+ ENL G +R DKA I I + Sbjct: 64 GERVVNDVAPKD---RDIAMVFQSYALYPHMTVAENLAFGLKLRGHDKATIDKRISEAAQ 120 Query: 128 IFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIMVDKIFEVVRD 187 L + D+L MSGG++Q +A+GRAL+ +P V LLDEP L + + + Sbjct: 121 TLG-LTDMMDKLPKAMSGGQRQRVALGRALVREPAVFLLDEPLSNLDAKLRHSVRTEIAQ 179 Query: 188 VY-ALGVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQLLNDP 233 ++ LG T++ V + A+ + R V++ G+I +L + P Sbjct: 180 LHRKLGTTMIYVTHDQVEAMTLGQRIVVLKDGVIQQIDTPMELYDRP 226 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 362 Length adjustment: 26 Effective length of query: 216 Effective length of database: 336 Effective search space: 72576 Effective search space used: 72576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory