Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_057508148.1 ABB28_RS08100 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_001431535.1:WP_057508148.1 Length = 362 Score = 291 bits (746), Expect = 1e-83 Identities = 170/355 (47%), Positives = 221/355 (62%), Gaps = 25/355 (7%) Query: 1 MAGIKIDKINKFYGTTQ-ALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGR 59 MA +++ + K Y Q A+ D ++ DGE +V VGPSGCGKSTLLR +AGLE +S G Sbjct: 1 MAKVQLQGVRKVYDNGQVAVKDATFEVADGELMVLVGPSGCGKSTLLRMIAGLEEISGGT 60 Query: 60 IEIGGRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAAR 119 + IG R V V P DRD+AMVFQSYALYPHMTV EN+ FG+K+ G + +RI+EAA+ Sbjct: 61 LTIGERVVNDVAPKDRDIAMVFQSYALYPHMTVAENLAFGLKLRGHDKATIDKRISEAAQ 120 Query: 120 VLQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGL 179 L L D +D+ P +SGGQRQRVA+GRA+V+ P+VFL DEPLSNLDAKLR +R E+ L Sbjct: 121 TLGLTDMMDKLPKAMSGGQRQRVALGRALVREPAVFLLDEPLSNLDAKLRHSVRTEIAQL 180 Query: 180 HKQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGSPAM 239 H++LG TMIYVTHDQVEAMT+ +IVVL G I+Q+ +PM+LY +P + FVA F+GSPAM Sbjct: 181 HRKLGTTMIYVTHDQVEAMTLGQRIVVLKDGVIQQIDTPMELYDRPANLFVAGFLGSPAM 240 Query: 240 NVF-------SSDVGLQDIS--------------LDASAAFVGCRPEHIEIVPDG-DGHI 277 NV +S V + D LD A VG RPEH++ G + Sbjct: 241 NVLRGTLQASASGVVVSDGDWKAPLGHATIDPRWLDKPIA-VGVRPEHLQPADAGAEWTF 299 Query: 278 AATVHVKERLGGESLLYLGLKGGGQIVARVGGDDETKVGAAVSLRFSRHRLHQFD 332 A + E +G E + L + G + RV VG + L + LH FD Sbjct: 300 EARIEGIEPVGNEIFVNL-VSGQHALTMRVAPRALPAVGETLKLAVQPNALHFFD 353 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 18 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 362 Length adjustment: 29 Effective length of query: 309 Effective length of database: 333 Effective search space: 102897 Effective search space used: 102897 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory