Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate WP_057508148.1 ABB28_RS08100 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= uniprot:D8IPI1 (406 letters) >NCBI__GCF_001431535.1:WP_057508148.1 Length = 362 Score = 322 bits (825), Expect = 1e-92 Identities = 168/364 (46%), Positives = 233/364 (64%), Gaps = 3/364 (0%) Query: 1 MADIHCQALAKHYAGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGT 60 MA + Q + K Y G + + DGE +VL+GPSGCGKST+LRMIAGLE+ISGGT Sbjct: 1 MAKVQLQGVRKVYDNGQVAVKDATFEVADGELMVLVGPSGCGKSTLLRMIAGLEEISGGT 60 Query: 61 LRIGGTVVNDLPARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAA 120 L IG VVND+ ++R++AMVFQ+YALYPHM+V +N+AFGL+ A ID+R+ E A Sbjct: 61 LTIGERVVNDVAPKDRDIAMVFQSYALYPHMTVAENLAFGLKLRGHDKATIDKRISEAAQ 120 Query: 121 LLNLEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRL 180 L L ++++ P+AMSGGQ+QR A+ RA+++ P+VFL DEPLSNLDAKLR +R +I +L Sbjct: 121 TLGLTDMMDKLPKAMSGGQRQRVALGRALVREPAVFLLDEPLSNLDAKLRHSVRTEIAQL 180 Query: 181 HQRLRTTTVYVTHDQLEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAM 240 H++L TT +YVTHDQ+EAMTL R+++++DG I Q +P ELY P NLF AGF+G+PAM Sbjct: 181 HRKLGTTMIYVTHDQVEAMTLGQRIVVLKDGVIQQIDTPMELYDRPANLFVAGFLGSPAM 240 Query: 241 NFLSGTVQRQDGQLFIETAHQRWALTGERFSRLRHAMAVKLAVRPDHVRIAGEREPAASL 300 N L GT+Q + + + L + + VRP+H++ A + A Sbjct: 241 NVLRGTLQASASGVVVSDGDWKAPLGHATIDPRWLDKPIAVGVRPEHLQPA---DAGAEW 297 Query: 301 TCPVSVELVEILGADALLTTRCGDQTLTALVPADRLPQPGATLTLALDQHELHVFDVESG 360 T +E +E +G + + G LT V LP G TL LA+ + LH FD E+G Sbjct: 298 TFEARIEGIEPVGNEIFVNLVSGQHALTMRVAPRALPAVGETLKLAVQPNALHFFDAETG 357 Query: 361 ENLS 364 E L+ Sbjct: 358 ERLN 361 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 362 Length adjustment: 30 Effective length of query: 376 Effective length of database: 332 Effective search space: 124832 Effective search space used: 124832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory