Align glucokinase (EC 2.7.1.1; EC 2.7.1.2; EC 2.7.1.8) (characterized)
to candidate WP_057508150.1 ABB28_RS08110 glucokinase
Query= ecocyc::GLUCOKIN-MONOMER (321 letters) >NCBI__GCF_001431535.1:WP_057508150.1 Length = 335 Score = 242 bits (617), Expect = 1e-68 Identities = 140/315 (44%), Positives = 178/315 (56%), Gaps = 9/315 (2%) Query: 6 LVGDVGGTNARLALCDIASGEI---SQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGCIA 62 LV D+GGTNAR AL D A + + +D+PSL R YL+E E G A Sbjct: 9 LVADIGGTNARFALADTADSSPLLEDSIREFPVVDFPSLGDAARHYLQEVDAEASRGVFA 68 Query: 63 IACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGA 122 +A + GD +TNH W S + LGFS L +INDF A +MAI +L+ + ++Q GGA Sbjct: 69 VAGRVDGDEARITNHPWVISRSRTAAMLGFSELHLINDFAAQAMAISLLQPKDVVQIGGA 128 Query: 123 E---PVEGKPI--AVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEIL 177 G P V G GTGLGV LV R L EGGHV F P + EE ILEIL Sbjct: 129 SWSPRRSGAPANYGVIGPGTGLGVGGLVIRHDRCFPLETEGGHVSFPPGTPEEIRILEIL 188 Query: 178 RAEIGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLF 237 G VS ER++ GPGLVN++RA+ + P +LKP D+T RA A RA+ LF Sbjct: 189 SETFGRVSNERLICGPGLVNIHRAVCEMAGFDPGHLKPADVTARAGAGD-PQAMRAVDLF 247 Query: 238 CVIMGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVY 297 C I G G+L L G + GVF+ GG+VPR LE + SGFR FE KGRF + +P Sbjct: 248 CAIFGAIAGDLVLIQGAWDGVFLTGGLVPRMLESLQHSGFRQRFEHKGRFSSIMGRVPSL 307 Query: 298 LIVHDNPGLLGSGAH 312 ++H NPGLLG+ A+ Sbjct: 308 AVIHPNPGLLGAAAY 322 Lambda K H 0.322 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 335 Length adjustment: 28 Effective length of query: 293 Effective length of database: 307 Effective search space: 89951 Effective search space used: 89951 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory