Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_057508252.1 ABB28_RS08680 LPS export ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_001431535.1:WP_057508252.1 Length = 239 Score = 129 bits (325), Expect = 4e-35 Identities = 77/234 (32%), Positives = 124/234 (52%), Gaps = 3/234 (1%) Query: 11 LLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSVVF 70 +L G+ Y + + + GE+V L+G NGAGK+T I G A GS+V Sbjct: 1 MLVAKGLRKSYKQREVVKDFGLTLEAGEVVGLLGPNGAGKTTCFYMIVGLVAADAGSIVL 60 Query: 71 EGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKHFAEDVEKIFTLF 130 +G+DIT P + A+ + P+ +F ++TV +N+++ L + A ++ +L Sbjct: 61 DGKDITSDPMYTRAKQGVGYLPQEPSVFRKLTVADNIRLVLELRDDLDRAGRERELASLL 120 Query: 131 PRLKERHA--QRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIRK 188 L+ H Q+G +LSGGE++ I RAL A+P+L+LLDEP G+ P+ V I + Sbjct: 121 DELQLGHVAEQQGASLSGGERRRCEIARALAAQPRLILLDEPFAGVDPISVGEIQRIVTH 180 Query: 189 LNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYL 242 L + G+ V + + N L + RAY++ G V G+ +LL N +VR YL Sbjct: 181 LKQ-RGIGVLITDHNVRETLGICDRAYILAEGTVLAQGAPADLLENADVRRVYL 233 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 239 Length adjustment: 23 Effective length of query: 224 Effective length of database: 216 Effective search space: 48384 Effective search space used: 48384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory