Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_057508252.1 ABB28_RS08680 LPS export ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_001431535.1:WP_057508252.1 Length = 239 Score = 148 bits (373), Expect = 1e-40 Identities = 87/251 (34%), Positives = 138/251 (54%), Gaps = 16/251 (6%) Query: 18 LLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLF 77 +L+A+GL KS+ V + ++ G + GL+GPNGAGKTT F ++ + D G ++ Sbjct: 1 MLVAKGLRKSYKQREVVKDFGLTLEAGEVVGLLGPNGAGKTTCFYMIVGLVAADAGSIVL 60 Query: 78 NGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFRRVQ 137 +G I + A +G Q V +LTV +N+ L ++ R Sbjct: 61 DGKDITSDPMYTRAKQGVGYLPQEPSVFRKLTVADNIRL-------------VLELR--D 105 Query: 138 KEERANREKAMA-MLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPAAG 196 +RA RE+ +A +L+ + LG A+ +LSGG+R+ E+ARAL + P+LILLDEP AG Sbjct: 106 DLDRAGRERELASLLDELQLGHVAEQQGASLSGGERRRCEIARALAAQPRLILLDEPFAG 165 Query: 197 VNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQIQSD 256 V+P +G+I + + ++GI L+ +HN+ + +C ++LAEG LA G P + + Sbjct: 166 VDPISVGEIQRIVTHLKQRGIGVLITDHNVRETLGICDRAYILAEGTVLAQGAPADLLEN 225 Query: 257 PRVLEAYLGDS 267 V YLGDS Sbjct: 226 ADVRRVYLGDS 236 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 239 Length adjustment: 24 Effective length of query: 243 Effective length of database: 215 Effective search space: 52245 Effective search space used: 52245 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory